Recombinant Human NKX6-3 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: NKX6-3-1116H
• Product Overview: NKX6 MS Standard C13 and N15-labeled recombinant protein (NP_689781) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: The NKX family of homeodomain proteins controls numerous developmental processes. Members of the NKX6 subfamily, including NKX6-3, are involved in development of the central nervous system (CNS), gastrointestinal tract, and pancreas.
• Molecular Mass: 14.1 kDa
• AA Sequence: MQQGQLAPGSRLCSGPWGLPELQPAAPSSSAAQLPWGESWGEEADTPACLSASGVWFQNRRTKWRKKSALEPSSSTPRAPGGAGAGAGGDRAPSENEDDEYNKPLDPDSDDEKIRLLLRKHRAAFSVLSLGAHSVTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: NKX6-3 NK6 homeobox 3 [ Homo sapiens (human) ]
• Official Symbol: NKX6-3
• Synonyms: NKX6-3; NK6 homeobox 3; NK6 transcription factor related, locus 3 (Drosophila); homeobox protein Nkx-6.3; FLJ25169; NK6 transcription factor related, locus 3; NKX6.3
• Gene ID: 157848
• mRNA Refseq: NM_152568
• Protein Refseq: NP_689781
• MIM: 610772
• UniProt ID: A6NJ46