Recombinant Full Length Human NKX6-3 Protein, GST-tagged

• Cat.No.: NKX6-3-6708HF
• Product Overview: Human NKX6-3 full-length ORF ( AAI56230.1, 1 a.a. - 135 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 135 amino acids
• Description: The NKX family of homeodomain proteins controls numerous developmental processes. Members of the NKX6 subfamily, including NKX6-3, are involved in development of the central nervous system (CNS), gastrointestinal tract, and pancreas (Alanentalo et al., 2006 [PubMed 16326147]).[supplied by OMIM
• Molecular Mass: 41.25 kDa
• AA Sequence: MQQGQLAPGSRLCSGPWGLPELQPAAPSSSAAQLPWGESWGEEADTPACLSASGVWFQNRRTKWRKKSALEPSSSTPRAPGGAGAGAGGDRAPSENEDDEYNKPLDPDSDDEKIRLLLRKHRAAFSVLSLGAHSV
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: NKX6-3 NK6 homeobox 3 [ Homo sapiens ]
• Official Symbol: NKX6-3
• Synonyms: NKX6-3; NK6 homeobox 3; NK6 transcription factor related, locus 3 (Drosophila); homeobox protein Nkx-6.3; FLJ25169; NK6 transcription factor related, locus 3; NKX6.3
• Gene ID: 157848
• mRNA Refseq: NM_152568
• Protein Refseq: NP_689781
• MIM: 610772
• UniProt ID: A6NJ46