Recombinant Human NKX6-2 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: NKX6-2-4929H
• Product Overview: NKX6 MS Standard C13 and N15-labeled recombinant protein (NP_796374) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: NKX6-2 (NK6 Homeobox 2) is a Protein Coding gene. Diseases associated with NKX6-2 include Spastic Ataxia 8, Autosomal Recessive, With Hypomyelinating Leukodystrophy and Spastic Ataxia 8. Gene Ontology (GO) annotations related to this gene include DNA-binding transcription factor activity and sequence-specific DNA binding. An important paralog of this gene is NKX6-1.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 29.1 kDa
• AA Sequence: MDTNRPGAFVLSSAPLAALHNMAEMKTSLFPYALQGPAGFKAPALGGLGAQLPLGTPHGISDILGRPVGAAGGGLLGGLPRLNGLASSAGVYFGPAAAVARGYPKPLAELPGRPPIFWPGVVQGAPWRDPRLAGPAPAGGVLDKDGKKKHSRPTFSGQQIFALEKTFEQTKYLAGPERARLAYSLGMTESQVKVWFQNRRTKWRKRHAAEMASAKKKQDSDAEKLKVGGSDAEDDDEYNRPLDPNSDDEKITRLLKKHKPSNLALVSPCGGGAGDALTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: NKX6-2 NK6 homeobox 2 [ Homo sapiens (human) ]
• Official Symbol: NKX6-2
• Synonyms: NKX6-2; NK6 homeobox 2; NK6 transcription factor related, locus 2 (Drosophila); homeobox protein Nkx-6.2; GTX; NKX6.1; NKX6B; homeobox 6B; NK homeobox family 6, B; homeobox protein NK-6 homolog B; NK6 transcription factor related, locus 2; glial and testis-specific homeobox protein; NKX6.2; MGC126684
• Gene ID: 84504
• mRNA Refseq: NM_177400
• Protein Refseq: NP_796374
• MIM: 605955
• UniProt ID: Q9C056