Recombinant Human NKX6-2 Protein, GST-tagged

• Cat.No.: NKX6-2-5906H
• Product Overview: Human NKX6-2 partial ORF ( NP_796374, 168 a.a. - 277 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Protein Length: 168-277 a.a.
• Description: NKX6-2 (NK6 Homeobox 2) is a Protein Coding gene. Diseases associated with NKX6-2 include Spastic Ataxia 8, Autosomal Recessive, With Hypomyelinating Leukodystrophy and Non-Functioning Pancreatic Endocrine Tumor. GO annotations related to this gene include transcription factor activity, sequence-specific DNA binding and sequence-specific DNA binding. An important paralog of this gene is NKX6-1.
• Molecular Mass: 37.84 kDa
• AA Sequence: EQTKYLAGPERARLAYSLGMTESQVKVWFQNRRTKWRKRHAAEMASAKKKQDSDAEKLKVGGSDAEDDDEYNRPLDPNSDDEKITRLLKKHKPSNLALVSPCGGGAGDAL
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: NKX6-2 NK6 homeobox 2 [ Homo sapiens ]
• Official Symbol: NKX6-2
• Synonyms: NKX6-2; NK6 homeobox 2; NK6 transcription factor related, locus 2 (Drosophila); homeobox protein Nkx-6.2; GTX; NKX6.1; NKX6B; homeobox 6B; NK homeobox family 6, B; homeobox protein NK-6 homolog B; NK6 transcription factor related, locus 2; glial and testis-specific homeobox protein; NKX6.2; MGC126684
• Gene ID: 84504
• mRNA Refseq: NM_177400
• Protein Refseq: NP_796374
• MIM: 605955
• UniProt ID: Q9C056