Recombinant Human NKX3-2 protein, His-tagged
Cat.No. : | NKX3-2-215H |
Product Overview : | Recombinant Human NKX3-2 protein(NP_001180)(1-333 aa), fused to His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-333 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | MAVRGANTLTSFSIQAILNKKEERGGLAAPEGRPAPGGTAASVAAAPAVCCWRLFGERDAGALGGAEDSLLASPAGTRTAAGRTAESPEGWDSDSALSEENESRRRCADARGASGAGLAGGSLSLGQPVCELAASKDLEEEAAGRSDSEMSASVSGDRSPRTEDDGVGPRGAHVSALCSGAGGGGGSGPAGVAEEEEEPAAPKPRKKRSRAAFSHAQVFELERRFNHQRYLSGPERADLAASLKLTETQVKIWFQNRRYKTKRRQMAADLLASAPAAKKVAVKVLVRDDQRQYLPGEVLRPPSLLPLQPSYYYPYYCLPGWALSTCAAAAGTQ |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Aliquot and store at -20°C to -80°C for up to 6 months. Avoid repeat freeze-thaw cycles. |
Concentration : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | NKX3-2 NK3 homeobox 2 [ Homo sapiens ] |
Official Symbol | NKX3-2 |
Synonyms | NKX3-2; NK3 homeobox 2; bagpipe homeobox homolog 1 (Drosophila) , BAPX1; homeobox protein Nkx-3.2; NKX3.2; NKX3B; homeobox protein NK-3 homolog B; bagpipe homeobox protein homolog 1; SMMD; BAPX1; MGC138171; |
Gene ID | 579 |
mRNA Refseq | NM_001189 |
Protein Refseq | NP_001180 |
MIM | 602183 |
UniProt ID | P78367 |
◆ Recombinant Proteins | ||
NKX3-2-3038R | Recombinant Rhesus monkey NKX3-2 Protein, His-tagged | +Inquiry |
NKX3-2-3630H | Recombinant Human NKX3-2 Protein, His (Fc)-Avi-tagged | +Inquiry |
NKX3-2-215H | Recombinant Human NKX3-2 protein, His-tagged | +Inquiry |
NKX3-2-2857R | Recombinant Rhesus Macaque NKX3-2 Protein, His (Fc)-Avi-tagged | +Inquiry |
Nkx3-2-1295H | Recombinant Human Nkx3-2 Protein, His/MYC-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NKX3-2 Products
Required fields are marked with *
My Review for All NKX3-2 Products
Required fields are marked with *
0
Inquiry Basket