Recombinant Human NKX3-2 protein, His-tagged

Cat.No. : NKX3-2-215H
Product Overview : Recombinant Human NKX3-2 protein(NP_001180)(1-333 aa), fused to His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1-333 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
AA Sequence : MAVRGANTLTSFSIQAILNKKEERGGLAAPEGRPAPGGTAASVAAAPAVCCWRLFGERDAGALGGAEDSLLASPAGTRTAAGRTAESPEGWDSDSALSEENESRRRCADARGASGAGLAGGSLSLGQPVCELAASKDLEEEAAGRSDSEMSASVSGDRSPRTEDDGVGPRGAHVSALCSGAGGGGGSGPAGVAEEEEEPAAPKPRKKRSRAAFSHAQVFELERRFNHQRYLSGPERADLAASLKLTETQVKIWFQNRRYKTKRRQMAADLLASAPAAKKVAVKVLVRDDQRQYLPGEVLRPPSLLPLQPSYYYPYYCLPGWALSTCAAAAGTQ
Purity : 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Aliquot and store at -20°C to -80°C for up to 6 months. Avoid repeat freeze-thaw cycles.
Concentration : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name NKX3-2 NK3 homeobox 2 [ Homo sapiens ]
Official Symbol NKX3-2
Synonyms NKX3-2; NK3 homeobox 2; bagpipe homeobox homolog 1 (Drosophila) , BAPX1; homeobox protein Nkx-3.2; NKX3.2; NKX3B; homeobox protein NK-3 homolog B; bagpipe homeobox protein homolog 1; SMMD; BAPX1; MGC138171;
Gene ID 579
mRNA Refseq NM_001189
Protein Refseq NP_001180
MIM 602183
UniProt ID P78367

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All NKX3-2 Products

Required fields are marked with *

My Review for All NKX3-2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon