Recombinant Human NKX2-6 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: NKX2-6-3578H
• Product Overview: NKX2 MS Standard C13 and N15-labeled recombinant protein (NP_001129743) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: Myc&DDK
• Description: This gene encodes a homeobox-containing protein that belongs to the NK-2 homeobox family. This protein is a vertebrate homolog of Drosophila homeobox-containing protein called 'tinman', which has been shown to be essential for development of the heart-like dorsal vessel. In conjunction with related gene, NKX2-5, this gene may play a role in both pharyngeal and cardiac embryonic development. Mutations in this gene are associated with persistent truncus arteriosus.
• Molecular Mass: 23.1 kDa
• AA Sequence: MDAERMGEPQPGLNAASPLGGGTRVPERGVGNSGDSVRGGRSEQPKARQRRKPRVLFSQAQVLALERRFKQQRYLSAPEREHLASALQLTSTQVKIWFQNRRYKCKRQRQDKSLELAGHPLTPRRVAVPVLVRDGKPCLGPGPGAPAFPSPYSAAVSPYSCYGGYSGAPYGAGYGTCYAGAPSGPAPHTPLASAGFGHGGQNATPQGHLAATLQGVRAWTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: NKX2-6 NK2 homeobox 6 [ Homo sapiens (human) ]
• Official Symbol: NKX2-6
• Synonyms: NKX2-6; NK2 homeobox 6; NK2 transcription factor related, locus 6 (Drosophila); homeobox protein Nkx-2.6; CSX2; NKX4 2; tinman paralog (Drosophila); tinman paralog; homeobox protein NKX2.6; homeobox protein NK2 homolog F; NK2 transcription factor related, locus 6; NKX2F; NKX4-2
• Gene ID: 137814
• mRNA Refseq: NM_001136271
• Protein Refseq: NP_001129743
• MIM: 611770
• UniProt ID: A6NCS4