Recombinant Human NKX2-2 Protein, GST-tagged

• Cat.No.: NKX2-2-5896H
• Product Overview: Human NKX2-2 full-length ORF ( ABZ92170.1, 1 a.a. - 273 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• ProteinLength: 1-273 a.a.
• Description: The protein encoded by this gene contains a homeobox domain and may be involved in the morphogenesis of the central nervous system. This gene is found on chromosome 20 near NKX2-4, and these two genes appear to be duplicated on chromosome 14 in the form of TITF1 and NKX2-8. The encoded protein is likely to be a nuclear transcription factor. [provided by RefSeq
• Molecular Mass: 30.1 kDa
• AA Sequence: MSLTNTKTGFSVKDILDLPDTNDEEGSVAEGPEEENEGPEPAKRAGPLGQGALDAVQSLPLKNPFYDSSDNPYTRWLASTEGLQYSLHGLAAGAPPQDSSSKSPEPSADESPDNDKETPGGGGDAGKKRKRRVLFSKAQTYELERRFRQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKMKRARAEKGMEVTPLPSPRRVAVPVLVRDGKPCHALKAQDLAAATFQAGIPFSAYSAQSLQHMQYNAQYSSASTPQYPTAHPLVQAQQWTW
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: NKX2-2 NK2 homeobox 2 [ Homo sapiens ]
• Official Symbol: NKX2-2
• Synonyms: NKX2-2; NK2 homeobox 2; NK 2 (Drosophila) homolog B , NK2 transcription factor related, locus 2 (Drosophila) , NKX2B; homeobox protein Nkx-2.2; NKX2.2; NK-2 homolog B; homeobox protein NK-2 homolog B; NK2 transcription factor-like protein B; NK2 transcription factor related, locus 2; NKX2B
• Gene ID: 4821
• mRNA Refseq: NM_002509
• Protein Refseq: NP_002500
• MIM: 604612
• UniProt ID: O95096