Recombinant Human NKAIN1 Protein, GST-tagged

• Cat.No.: NKAIN1-5884H
• Product Overview: Human NKAIN1 full-length ORF (BAB14196.1, 1 a.a. - 163 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: NKAIN1 is a member of a family of mammalian proteins with similarity to Drosophila Nkain and interacts with the beta subunit of Na,K-ATPase (ATP1B1; MIM 182330) (Gorokhova et al., 2007 [PubMed 17606467]).[supplied by OMIM
• Molecular Mass: 45 kDa
• AA Sequence: MAVILGIFGTVQYRSRYLILYAAWLVLWVGWNAFIICFYLEVGQLSQDRDFIMTFNTSLHRSWWMENGPGCLVTPVLNSRLALEDHHVISVTGCLLDYPYIEALSSALQIFLALFGFVFACYVSKVFLEEEDSFDFIGGFDSYGYQAPQKTSHLQLQPLYTSG
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: NKAIN1 Na+/K+ transporting ATPase interacting 1 [ Homo sapiens ]
• Official Symbol: NKAIN1
• Synonyms: NKAIN1; Na+/K+ transporting ATPase interacting 1; FAM77C, family with sequence similarity 77, member C; sodium/potassium-transporting ATPase subunit beta-1-interacting protein 1; FLJ12650; family with sequence similarity 77, member C; Na(+)/K(+)-transporting ATPase subunit beta-1-interacting protein 1; FAM77C
• Gene ID: 79570
• mRNA Refseq: NM_024522
• Protein Refseq: NP_078798
• MIM: 612871
• UniProt ID: Q4KMZ8