Recombinant Full Length Human NKAIN1 Protein, GST-tagged

Cat.No. : NKAIN1-6646HF
Product Overview : Human NKAIN1 full-length ORF (BAB14196.1, 1 a.a. - 163 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 163 amino acids
Description : NKAIN1 is a member of a family of mammalian proteins with similarity to Drosophila Nkain and interacts with the beta subunit of Na,K-ATPase (ATP1B1; MIM 182330) (Gorokhova et al., 2007 [PubMed 17606467]).[supplied by OMIM
Molecular Mass : 45 kDa
AA Sequence : MAVILGIFGTVQYRSRYLILYAAWLVLWVGWNAFIICFYLEVGQLSQDRDFIMTFNTSLHRSWWMENGPGCLVTPVLNSRLALEDHHVISVTGCLLDYPYIEALSSALQIFLALFGFVFACYVSKVFLEEEDSFDFIGGFDSYGYQAPQKTSHLQLQPLYTSG
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name NKAIN1 Na+/K+ transporting ATPase interacting 1 [ Homo sapiens ]
Official Symbol NKAIN1
Synonyms NKAIN1; Na+/K+ transporting ATPase interacting 1; FAM77C, family with sequence similarity 77, member C; sodium/potassium-transporting ATPase subunit beta-1-interacting protein 1; FLJ12650; family with sequence similarity 77, member C; Na(+)/K(+)-transporting ATPase subunit beta-1-interacting protein 1; FAM77C;
Gene ID 79570
mRNA Refseq NM_024522
Protein Refseq NP_078798
MIM 612871
UniProt ID Q4KMZ8

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All NKAIN1 Products

Required fields are marked with *

My Review for All NKAIN1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon