Recombinant Human NIPAL3 Protein, GST-tagged
Cat.No. : | NIPAL3-5177H |
Product Overview : | Human DJ462O23.2 full-length ORF ( AAH01265, 21 a.a. - 226 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | NIPAL3 (NIPA Like Domain Containing 3) is a Protein Coding gene. Among its related pathways are Transport of glucose and other sugars, bile salts and organic acids, metal ions and amine compounds and Miscellaneous transport and binding events. GO annotations related to this gene include magnesium ion transmembrane transporter activity. An important paralog of this gene is NIPAL2. |
Molecular Mass : | 48.4 kDa |
AA Sequence : | SAVSEASFSYKENLIGALLAIFGHLVVSIALNLQKYCHIRLAGSKDPRAYFKTKTWWLGLFLMLLGELGVFASYAFAPLSLIVPLSAVSVIASAIIGIIFIKEKWKPKDFLRRYVLSFVGCGLAVVGTYLLVTFAPNSHEKMTGENVTRHLVSWPFLLYMLVEIILFCLLLYFYKEKNANNIVVILLLVALLVLLCHPGWSAVVQS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | NIPAL3 NIPA like domain containing 3 [ Homo sapiens (human) ] |
Official Symbol | NIPAL3 |
Synonyms | NPAL3; NIPAL3; NIPA like domain containing 3; DJ462O23.2; NIPA-like protein 3 |
Gene ID | 57185 |
mRNA Refseq | NM_001322854 |
Protein Refseq | NP_001309783 |
UniProt ID | Q6P499 |
◆ Recombinant Proteins | ||
NIPAL3-5177H | Recombinant Human NIPAL3 Protein, GST-tagged | +Inquiry |
NIPAL3-3841HF | Recombinant Full Length Human NIPAL3 Protein, GST-tagged | +Inquiry |
NIPAL3-745Z | Recombinant Zebrafish NIPAL3 | +Inquiry |
◆ Cell & Tissue Lysates | ||
NIPAL3-1207HCL | Recombinant Human NIPAL3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NIPAL3 Products
Required fields are marked with *
My Review for All NIPAL3 Products
Required fields are marked with *
0
Inquiry Basket