Recombinant Full Length Human NIPAL3 Protein, GST-tagged

• Cat.No.: NIPAL3-3841HF
• Product Overview: Human DJ462O23.2 full-length ORF ( AAH01265, 21 a.a. - 226 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• ProteinLength: 226 amino acids
• Description: NIPAL3 (NIPA Like Domain Containing 3) is a Protein Coding gene. Among its related pathways are Transport of glucose and other sugars, bile salts and organic acids, metal ions and amine compounds and Miscellaneous transport and binding events. GO annotations related to this gene include magnesium ion transmembrane transporter activity. An important paralog of this gene is NIPAL2.
• Molecular Mass: 48.4 kDa
• AA Sequence: SAVSEASFSYKENLIGALLAIFGHLVVSIALNLQKYCHIRLAGSKDPRAYFKTKTWWLGLFLMLLGELGVFASYAFAPLSLIVPLSAVSVIASAIIGIIFIKEKWKPKDFLRRYVLSFVGCGLAVVGTYLLVTFAPNSHEKMTGENVTRHLVSWPFLLYMLVEIILFCLLLYFYKEKNANNIVVILLLVALLVLLCHPGWSAVVQS
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: NIPAL3 NIPA like domain containing 3 [ Homo sapiens (human) ]
• Official Symbol: NIPAL3
• Synonyms: NPAL3; NIPAL3; NIPA like domain containing 3; DJ462O23.2; NIPA-like protein 3
• Gene ID: 57185
• mRNA Refseq: NM_001322854
• Protein Refseq: NP_001309783
• MIM: 620034
• UniProt ID: Q6P499