Recombinant Full Length Human NIPAL3 Protein, GST-tagged

Cat.No. : NIPAL3-3841HF
Product Overview : Human DJ462O23.2 full-length ORF ( AAH01265, 21 a.a. - 226 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 226 amino acids
Description : NIPAL3 (NIPA Like Domain Containing 3) is a Protein Coding gene. Among its related pathways are Transport of glucose and other sugars, bile salts and organic acids, metal ions and amine compounds and Miscellaneous transport and binding events. GO annotations related to this gene include magnesium ion transmembrane transporter activity. An important paralog of this gene is NIPAL2.
Molecular Mass : 48.4 kDa
AA Sequence : SAVSEASFSYKENLIGALLAIFGHLVVSIALNLQKYCHIRLAGSKDPRAYFKTKTWWLGLFLMLLGELGVFASYAFAPLSLIVPLSAVSVIASAIIGIIFIKEKWKPKDFLRRYVLSFVGCGLAVVGTYLLVTFAPNSHEKMTGENVTRHLVSWPFLLYMLVEIILFCLLLYFYKEKNANNIVVILLLVALLVLLCHPGWSAVVQS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name NIPAL3 NIPA like domain containing 3 [ Homo sapiens (human) ]
Official Symbol NIPAL3
Synonyms NPAL3; NIPAL3; NIPA like domain containing 3; DJ462O23.2; NIPA-like protein 3
Gene ID 57185
mRNA Refseq NM_001322854
Protein Refseq NP_001309783
MIM 620034
UniProt ID Q6P499

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All NIPAL3 Products

Required fields are marked with *

My Review for All NIPAL3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon