Recombinant Human NGB Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | NGB-1854H |
Product Overview : | NGB MS Standard C13 and N15-labeled recombinant protein (NP_067080) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes an oxygen-binding protein that is distantly related to members of the globin gene family. It is highly conserved among other vertebrates. It is expressed in the central and peripheral nervous system where it may be involved in increasing oxygen availability and providing protection under hypoxic/ischemic conditions. |
Molecular Mass : | 16.9 kDa |
AA Sequence : | MERPEPELIRQSWRAVSRSPLEHGTVLFARLFALEPDLLPLFQYNCRQFSSPEDCLSSPEFLDHIRKVMLVIDAAVTNVEDLSSLEEYLASLGRKHRAVGVKLSSFSTVGESLLYMLEKCLGPAFTPATRAAWSQLYGAVVQAMSRGWDGETRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | NGB neuroglobin [ Homo sapiens (human) ] |
Official Symbol | NGB |
Synonyms | NGB; neuroglobin; neuroglobin |
Gene ID | 58157 |
mRNA Refseq | NM_021257 |
Protein Refseq | NP_067080 |
MIM | 605304 |
UniProt ID | Q9NPG2 |
◆ Recombinant Proteins | ||
NGB-3275H | Recombinant Human NGB protein, His-SUMO-tagged | +Inquiry |
NGB-1025H | Recombinant Human NGB Protein, GST-tagged | +Inquiry |
NGB-3639R | Recombinant Rat NGB Protein, His (Fc)-Avi-tagged | +Inquiry |
NGB-9358Z | Recombinant Zebrafish NGB | +Inquiry |
NGB-1854H | Recombinant Human NGB Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
NGB-3837HCL | Recombinant Human NGB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NGB Products
Required fields are marked with *
My Review for All NGB Products
Required fields are marked with *
0
Inquiry Basket