Recombinant Human NGB Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: NGB-1854H
• Product Overview: NGB MS Standard C13 and N15-labeled recombinant protein (NP_067080) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: This gene encodes an oxygen-binding protein that is distantly related to members of the globin gene family. It is highly conserved among other vertebrates. It is expressed in the central and peripheral nervous system where it may be involved in increasing oxygen availability and providing protection under hypoxic/ischemic conditions.
• Molecular Mass: 16.9 kDa
• AA Sequence: MERPEPELIRQSWRAVSRSPLEHGTVLFARLFALEPDLLPLFQYNCRQFSSPEDCLSSPEFLDHIRKVMLVIDAAVTNVEDLSSLEEYLASLGRKHRAVGVKLSSFSTVGESLLYMLEKCLGPAFTPATRAAWSQLYGAVVQAMSRGWDGETRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: NGB neuroglobin [ Homo sapiens (human) ]
• Official Symbol: NGB
• Synonyms: NGB; neuroglobin; neuroglobin
• Gene ID: 58157
• mRNA Refseq: NM_021257
• Protein Refseq: NP_067080
• MIM: 605304
• UniProt ID: Q9NPG2