Recombinant Human NFYA Protein, GST-tagged

• Cat.No.: NFYA-201H
• Product Overview: Recombinant Human NFYA, transcript variant 2, fused with GST tag at N-terminal was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Description: The protein encoded by this gene is one subunit of a trimeric complex, forming a highly conserved transcription factor that binds to CCAAT motifs in the promoter regions in a variety of genes. Subunit A associates with a tight dimer composed of the B and C subunits, resulting in a trimer that binds to DNA with high specificity and affinity. The sequence specific interactions of the complex are made by the A subunit, suggesting a role as the regulatory subunit. In addition, there is evidence of post-transcriptional regulation in this gene product, either by protein degradation or control of translation. Further regulation is represented by alternative splicing in the glutamine-rich activation domain, with clear tissue-specific preferences for the two isoforms.
• Form: Lyophilized from a 0.2 µM filtered solution of 20mM PB, 150mM NaCl, pH 7.2
• Molecular Mass: 60.58kD
• AA Sequence: MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLVPRGSPEFMEQYTANSNSSTEQIVVQAGQIQQQV
• Endotoxin: Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
• Purity: >95% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.

Gene Information

• Gene Name: NFYA nuclear transcription factor Y, alpha [ Homo sapiens ]
• Official Symbol: NFYA
• Synonyms: NFYA; nuclear transcription factor Y, alpha; nuclear transcription factor Y subunit alpha; CBF B; HAP2; NF YA; HAP2 CCAAT-binding protein; Transcription factor NF-Y, A subunit; CAAT box DNA-binding protein subunit A; CAAT-box DNA binding protein subunit A; nuclear transcription factor Y subunit A; CCAAT-binding transcription factor subunit B; CBF-A; CBF-B; NF-YA; FLJ11236
• Gene ID: 4800
• mRNA Refseq: M_021705
• Protein Refseq: NP_068351
• MIM: 189903
• UniProt ID: P23511