Recombinant Human NFE2L3 protein, His-tagged
Cat.No. : | NFE2L3-3386H |
Product Overview : | Recombinant Human NFE2L3 protein(74-258 aa), fused to His tag, was expressed in E. coli. |
Availability | April 28, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 74-258 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | LHPKGRELDPAAPPEGQLLREVRALGVPFVPRTSVDAWLVHSVAAGSADEAHGLLGAAAASSTGGAGASVDGGSQAVQGGGGDPRAARSGPLDAGEEEKAPAEPTAQVPDAGGCASEENGVLREKHEAVDHSSQHEENEERVSAQKENSLQQNDDDENKIAEKPDWEAEKTTESRNERHLNGTDT |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | NFE2L3 nuclear factor (erythroid-derived 2)-like 3 [ Homo sapiens ] |
Official Symbol | NFE2L3 |
Synonyms | NFE2L3; nuclear factor (erythroid-derived 2)-like 3; nuclear factor erythroid 2-related factor 3; Nrf3; NFE2-related factor 3; NF-E2-related factor 3; nuclear factor, erythroid derived 2, like 3; nuclear factor-erythroid 2-related factor 3; nuclear factor-erythroid 2 p45-related factor 3; NRF3; |
Gene ID | 9603 |
mRNA Refseq | NM_004289 |
Protein Refseq | NP_004280 |
MIM | 604135 |
UniProt ID | Q9Y4A8 |
◆ Recombinant Proteins | ||
NFE2L3-187H | Recombinant Human NFE2L3 Protein, His-tagged | +Inquiry |
NFE2L3-1277H | Recombinant Human NFE2L3, GST-tagged | +Inquiry |
NFE2L3-3386H | Recombinant Human NFE2L3 protein, His-tagged | +Inquiry |
NFE2L3-12433Z | Recombinant Zebrafish NFE2L3 | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NFE2L3 Products
Required fields are marked with *
My Review for All NFE2L3 Products
Required fields are marked with *
0
Inquiry Basket