Recombinant Human NFE2
Cat.No. : | NFE2-28428TH |
Product Overview : | Recombinant full length Human Nuclear Factor Erythroid Derived 2 with N terminal proprietary tag. Predicted MW 66.77 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
ProteinLength : | 373 amino acids |
Description : | Transcription factor NF-E2 45 kDa subunit is a protein that in humans is encoded by the NFE2 gene. |
Molecular Weight : | 66.770kDa inclusive of tags |
Tissue specificity : | Expressed in hematopoietic cells and also in colon and testis. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MSPCPPQQSRNRVIQLSTSELGEMELTWQEIMSITELQGL NAPSEPSFEPQAPAPYLGPPPPTTYCPCSIHPDSGFPLPP PPYELPASTSHVPDPPYSYGNMAIPVSKPLSLSGLLSEPL QDPLALLDIGLPAGPPKPQEDPESDSGLSLNYSDAESLEL EGTEAGRRRSEYVEMYPVEYPYSLMPNSLAHSNYTLPAAE TPLALEPSSGPVRAKPTARGEAGSRDERRALAMKIPFPTD KIVNLPVDDFNELLARYPLTESQLALVRDIRRRGKNKVAA QNCRKRKLETIVQLERELERLTNERERLLRARGEADRTLE VMRQQLTELYRDIFQHLRDESGNSYSPEEYALQQAADGTI FLVPRGTKMEATD |
Sequence Similarities : | Belongs to the bZIP family. CNC subfamily.Contains 1 bZIP domain. |
Gene Name | NFE2 nuclear factor (erythroid-derived 2), 45kDa [ Homo sapiens ] |
Official Symbol | NFE2 |
Synonyms | NFE2; nuclear factor (erythroid-derived 2), 45kDa; nuclear factor (erythroid derived 2), 45kD; transcription factor NF-E2 45 kDa subunit; NF E2; |
Gene ID | 4778 |
mRNA Refseq | NM_001136023 |
Protein Refseq | NP_001129495 |
MIM | 601490 |
Uniprot ID | Q16621 |
Chromosome Location | 12q13 |
Pathway | Factors involved in megakaryocyte development and platelet production, organism-specific biosystem; Hemostasis, organism-specific biosystem; |
Function | WW domain binding; WW domain binding; protein N-terminus binding; protein dimerization activity; sequence-specific DNA binding; |
◆ Recombinant Proteins | ||
VEGFB-6558H | Recombinant Human VEGFB Protein (Pro22-Ala207), N-His tagged | +Inquiry |
PROK1-3436R | Recombinant Rhesus Macaque PROK1 Protein, His (Fc)-Avi-tagged | +Inquiry |
ARHGEF4-1237HF | Recombinant Full Length Human ARHGEF4 Protein, GST-tagged | +Inquiry |
DYNLT1C-4918M | Recombinant Mouse DYNLT1C Protein | +Inquiry |
RFL1209AF | Recombinant Full Length Acidithiobacillus Ferrooxidans Atp Synthase Subunit B(Atpf) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
DNASE1-8333B | Native Bovine DNASE1 | +Inquiry |
Fgb -68R | Native Rat Fibrinogen | +Inquiry |
COL1A1-26195TH | Native Human COL1A1 | +Inquiry |
GG-186G | Native Goat Gamma Globulin protein | +Inquiry |
IgA-240B | Native Bovine Immunoglobulin A | +Inquiry |
◆ Cell & Tissue Lysates | ||
RAB43-2590HCL | Recombinant Human RAB43 293 Cell Lysate | +Inquiry |
CLVS1-7425HCL | Recombinant Human CLVS1 293 Cell Lysate | +Inquiry |
BAG6-8511HCL | Recombinant Human BAT3 293 Cell Lysate | +Inquiry |
DNAI2-491HCL | Recombinant Human DNAI2 cell lysate | +Inquiry |
RNFT2-550HCL | Recombinant Human RNFT2 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All NFE2 Products
Required fields are marked with *
My Review for All NFE2 Products
Required fields are marked with *
0
Inquiry Basket