Recombinant Human NEUROD1 protein, T7/His-tagged

• Cat.No.: NEUROD1-224H
• Product Overview: Recombinant human NeuroD1 (355aa) fused with T7-His-TEV cleavage site Tag at N-terminal and 11 arginine (11R tag) at its C-terminal was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: His&T7
• Form: 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT.
• AA Sequence: 29aa_Tag_TKSYSESGLMGEPQPQGPPSWTDECLSSQDEEHEADKKEDDLEAMNAEEDSLRNGGEEEDEDEDLE EEEEEEEEDDDQKPKRRGPKKKKMTKARLERFKLRRMKANARERNRMHGLNAALDNLRKVVPCYSKTQKLSKIET LRLAKNYIWALSEILRSGKSPDLVSFVQTLCKGLSQPTTNLVAGCLQLNPRTFLPEQNQDMPPHLPTASASFPVH PYSYQSPGLPSPPYGTMDSSHVFHVKPPPHAYSAALEPFFESPLTDCTSPSFDGPLSPPLSINGNFSFKHEPSAE FEKNYAFTMHYPAATLAGAQSHGSIFSGTAAPRCEIPIDNIMSFDSHSHHERVMSAQLNAIFHDLEESGGGGSPG RRRRRRRRRRR
• Purity: >90% by SDS-PAGE.
• Applications: 1. May be used for in vitro NeuroD1 mediated gene transcription regulation study for neuronal cell differentiation by intracellular delivery of this protein2. May be used for mapping NeuroD1 protein-protein interaction.3. May be used as specific substrate protein for kinase, and ubiquitin (Sumo pathway) related enzyme functional screening assays.4. As Immunogen for specific antibody development.
• Storage: Keep at -80°C for long term storage. Product is stable at 4 °C for at least 7 days.

Gene Information

• Gene Name: NEUROD1 neuronal differentiation 1 [ Homo sapiens ]
• Official Symbol: NEUROD1
• Synonyms: NEUROD1; neuronal differentiation 1; NEUROD, neurogenic differentiation 1; beta cell E box transactivator 2; BETA2; BHF 1; bHLHa3; MODY6; NeuroD;BHF-1; NEUROD
• Gene ID: 4760
• mRNA Refseq: NM_002500
• Protein Refseq: NP_002491
• MIM: 601724
• UniProt ID: Q13562
• Chromosome Location: 2q32
• Pathway: Developmental Biology, organism-specific biosystem; Maturity onset diabetes of the young, organism-specific biosystem; Maturity onset diabetes of the young, conserved biosystem; Regulation of beta-cell development, organism-specific biosystem; Regulation of gene expression in beta cells, organism-specific biosystem; Regulation of gene expression in endocrine-committed (NEUROG3+) progenitor cells, organism-specific biosystem
• Function: E-box binding; RNA polymerase II activating transcription factor binding; RNA polymerase II transcription coactivator activity; chromatin binding; double-stranded DNA binding; protein binding; protein heterodimerization activity; protein heterodimerization activity; contributes_to sequence-specific DNA binding