Recombinant Full Length Human NEUROD1 Protein, C-Flag-tagged
Cat.No. : | NEUROD1-389HFL |
Product Overview : | Recombinant Full Length Human NEUROD1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a member of the NeuroD family of basic helix-loop-helix (bHLH) transcription factors. The protein forms heterodimers with other bHLH proteins and activates transcription of genes that contain a specific DNA sequence known as the E-box. It regulates expression of the insulin gene, and mutations in this gene result in type II diabetes mellitus. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 39.7 kDa |
AA Sequence : | MTKSYSESGLMGEPQPQGPPSWTDECLSSQDEEHEADKKEDDLEAMNAEEDSLRNGGEEEDEDEDLEEEE EEEEEDDDQKPKRRGPKKKKMTKARLERFKLRRMKANARERNRMHGLNAALDNLRKVVPCYSKTQKLSKI ETLRLAKNYIWALSEILRSGKSPDLVSFVQTLCKGLSQPTTNLVAGCLQLNPRTFLPEQNQDMPPHLPTA SASFPVHPYSYQSPGLPSPPYGTMDSSHVFHVKPPPHAYSAALEPFFESPLTDCTSPSFDGPLSPPLSIN GNFSFKHEPSAEFEKNYAFTMHYPAATLAGAQSHGSIFSGTAAPRCEIPIDNIMSFDSHSHHERVMSAQL NAIFHDTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Adult stem cells, Druggable Genome, Embryonic stem cells, ES Cell Differentiation/IPS, Transcription Factors |
Protein Pathways : | Maturity onset diabetes of the young |
Full Length : | Full L. |
Gene Name | NEUROD1 neuronal differentiation 1 [ Homo sapiens (human) ] |
Official Symbol | NEUROD1 |
Synonyms | T2D; BETA2; BHF-1; MODY6; NEUROD; bHLHa3 |
Gene ID | 4760 |
mRNA Refseq | NM_002500.5 |
Protein Refseq | NP_002491.3 |
MIM | 601724 |
UniProt ID | Q13562 |
◆ Recombinant Proteins | ||
NEUROD1-6482C | Recombinant Chicken NEUROD1 | +Inquiry |
NEUROD1-1505H | Recombinant Human NEUROD1 Protein, His (Fc)-Avi-tagged | +Inquiry |
NEUROD1-8614Z | Recombinant Zebrafish NEUROD1 | +Inquiry |
NEUROD1-1268H | Recombinant Human NEUROD1, GST-tagged | +Inquiry |
NEUROD1-224H | Recombinant Human NEUROD1 protein, T7/His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NEUROD1-3868HCL | Recombinant Human NEUROD1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NEUROD1 Products
Required fields are marked with *
My Review for All NEUROD1 Products
Required fields are marked with *
0
Inquiry Basket