Recombinant Human NDUFB6

• Cat.No.: NDUFB6-29478TH
• Product Overview: Recombinant fragment of Human NDUFB6 with a N terminal proprietary tag; Predicted MWt 39.82 kDa.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 128 amino acids
• Description: The protein encoded by this gene is a subunit of the multisubunit NADH:ubiquinone oxidoreductase (complex I). Mammalian complex I is composed of 45 different subunits. It locates at the mitochondrial inner membrane. This protein has NADH dehydrogenase activity and oxidoreductase activity. It transfers electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone. Alternative splicing occurs at this locus and three transcript variants encoding distinct isoforms have been identified.
• Molecular Weight: 39.820kDa inclusive of tags
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: MTGYTPDEKLRLQQLRELRRRWLKDQELSPREPVLPPQKM GPMEKFWNKFLENKSPWRKMVHGVYKKSIFVFTHVLVPVW IIHYYMKYHVSEKPYGIVEKKSRIFPGDTILETGEVIPPM KEFPDQHH
• Sequence Similarities: Belongs to the complex I NDUFB6 subunit family.

Gene Information

• Gene Name: NDUFB6 NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 6, 17kDa [ Homo sapiens ]
• Official Symbol: NDUFB6
• Synonyms: NDUFB6; NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 6, 17kDa; NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 6 (17kD, B17); NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6; B17; CI; complex I; mitochondrial respiratory chain; B17 su
• Gene ID: 4712
• mRNA Refseq: NM_001199987
• Protein Refseq: NP_001186916
• MIM: 603322
• Uniprot ID: O95139
• Chromosome Location: 9p13.2
• Pathway: Alzheimers disease, organism-specific biosystem; Alzheimers disease, conserved biosystem; Electron Transport Chain, organism-specific biosystem; Huntingtons disease, organism-specific biosystem; Huntingtons disease, conserved biosystem
• Function: NADH dehydrogenase (ubiquinone) activity