Recombinant Human NDUFB11, His-tagged

• Cat.No.: NDUFB11-154H
• Product Overview: Recombinant Human NADH Dehydrogenase [Ubiquinone] 1 β Subcomplex Subunit 11 Mitochondrial/NDUFB11 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Glu30-Glu153) of Human NDUFB11 fused with a 6His tag at the C-terminus.

Specification

• Species: Human
• Source: HEK293
• Tag: His
• Protein Length: 30-153 a.a.
• Description: NADH Dehydrogenase [Ubiquinone] 1 β Subcomplex Subunit 11 Mitochondrial (NDUFB11) belongs to the complex I NDUFB11 subunit family. NDUFB11 is a single-pass membrane protein and is a component of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). Complex I catalyzes the first step in the electron transport chain, the transfer of 2 electrons from NADH to ubiquinone, coupled to the translocation of 4 protons across the membrane. The immediate electron acceptor for the enzyme is believed to be ubiquinone.
• AA Sequence: ESSFSRTVVAPSAVAGKRPPEPTTPWQEDPEPEDENLYEKNPDSHGYDKDPVLDVWNMRLVFFFG VSIILVLGSTFVAYLPDYRMKEWSRREAERLVKYREANGLPIMESNCFDPSKIQLPEDEVDHHHH HH
• Endotoxin: Less than 0.1 ng/μg (1 IEU/μg).
• Purity: Greater than 95% as determined by reducing SDS-PAGE.

Gene Information

• Gene Name: NDUFB11 NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 11, 17.3kDa [ Homo sapiens ]
• Official Symbol: NDUFB11
• Synonyms: NDUFB11; NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 11, 17.3kDa; NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial; complex I NP17.3 subunit; ESSS; Np15; NP17.3; complex I-ESSS; neuronal protein 17.3; NADH-ubiquinone oxidoreductase ESSS subunit; P17.3; CI-ESSS; FLJ20494; MGC111182
• Gene ID: 54539
• mRNA Refseq: NM_001135998
• Protein Refseq: NP_001129470
• MIM: 300403
• UniProt ID: Q9NX14
• Chromosome Location: Xp11.3
• Pathway: Alzheimers disease, organism-specific biosystem; Alzheimers disease, conserved biosystem; Huntingtons disease, organism-specific biosystem; Huntingtons disease, conserved biosystem; Metabolic pathways, organism-specific biosystem; Metabolism, organism-specific biosystem; NADH dehydrogenase (ubiquinone) 1 beta subcomplex, organism-specific biosystem