Recombinant Human NDUFA2 protein, GST-tagged

• Cat.No.: NDUFA2-1222H
• Product Overview: Recombinant Human NDUFA2 protein(1-99 aa), fused with N-terminal GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 1-99 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• AA Sequence: MAAAAASRGVGAKLGLREIRIHLCQRSPGSQGVRDFIEKRYVELKKANPDLPILIRECSDVQPKLWARYAFGQETNVPLNNFSADQVTRALENVLSGKA
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.

Gene Information

• Official Symbol: NDUFA2
• Synonyms: NDUFA2; NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 2, 8kDa; NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 2 (8kD, B8); NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2; B8; complex I B8 subunit; NADH-ubiquinone oxidoreductase subunit CI-B8; CD14; CIB8
• Gene ID: 4695
• mRNA Refseq: NM_001185012
• Protein Refseq: NP_001171941
• MIM: 602137
• UniProt ID: O43678