Recombinant Human NCR1 protein, T7/His-tagged

• Cat.No.: NCR1-87H
• Product Overview: Recombinant human CD335 extracellular domain cDNA (22-258 aa, Isoform-a) fused with T7-His-TEV cleavage site Tag (29aa) at N-terminal was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His&T7
• Protein Length: 22-258 a.a.
• Form: 0.50 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT.
• AA Sequence: MASMTGGQQMGRGHHHHHHGNLYFQGEFQQQTLPKPFIWAEPHFMVPKEKQVTICCQGNYGAVEYQLHFEGSLFA VDRPKPPERINKVKFYIPDMNSRMAGQYSCIYRVGELWSEPSNLLDLVVTEMYDTPTLSVHPGPEVISGEKVTFY CRLDTATSMFLLLKEGRSSHVQRGYGKVQAEFPLGPVTTAHRGTYRCFGSYNNHAWSFPSEPVKLLVTGDIENTS LAPEDPTFPADTWGTYLLTTETGLQKDHALWDHTAQNLLR
• Purity: >90% by SDS-PAGE
• Applications: 1. May be used for in vitro CD335 mediated NK cell activation regulatory study with this protein as either soluble factor or coating matrix.2. May be used for CD335 protein-protein interaction assay.3. Potential biomarker for Sezary syndrome diagnosis when combined with PLS3, Twist, KIR3DL2 protein detection.4. May be used for specific antibody production.
• Storage: Keep at -80centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days.

Gene Information

• Gene Name: NCR1 natural cytotoxicity triggering receptor 1 [ Homo sapiens ]
• Official Symbol: NCR1
• Synonyms: NCR1; natural cytotoxicity triggering receptor 1; LY94, lymphocyte antigen 94 (mouse) homolog (activating NK receptor; NK p46); CD335; NK p46; NKP46; NK cell-activating receptor; natural killer cell p46-related protein; lymphocyte antigen 94 homolog (act
• Gene ID: 9437
• mRNA Refseq: NM_001145457
• Protein Refseq: NP_001138929
• MIM: 604530
• UniProt ID: O76036
• Chromosome Location: 19
• Pathway: Natural killer cell mediated cytotoxicity, organism-specific biosystem; Natural killer cell mediated cytotoxicity, conserved biosystem
• Function: receptor activity; receptor signaling protein activity