Recombinant Human NCR1 Protein, Fc-tagged
Cat.No. : | NCR1-400H |
Product Overview : | Recombinant human NCR1 protein with Fc tag was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | Fc |
Protein Length : | 304 |
Description : | Predicted to be involved in cellular defense response; regulation of natural killer cell mediated cytotoxicity; and signal transduction. Predicted to act upstream of or within defense response to virus and detection of virus. Predicted to be located in cell surface. Predicted to be part of SWI/SNF complex. Predicted to be active in plasma membrane. Biomarker of acquired immunodeficiency syndrome; anogenital venereal wart; hepatitis C; and lymphoproliferative syndrome. |
Form : | Lyophilized |
Molecular Mass : | 53 kDa |
AA Sequence : | MSSTLPALLCVGLCLSQRISAQQQTLPKPFIWAEPHFMVPKEKQVTICCQGNYGAVEYQLHFEGSLFAVDRPKPPERINKVKFYIPDMNSRMAGQYSCIYRVGELWSEPSNLLDLVVTEMYDTPTLSVHPGPEVISGEKVTFYCRLDTATSMFLLLKEGRSSHVQRGYGKVQAEFPLGPVTTAHRGTYRCFGSYNNHAWSFPSEPVKLLVTGDIENTSLAPEDPTFPADTWGTYLLTTETGLQKDHALWDHTAQNLLRMGLAFLVLVALVWFLVEDWLSRKRTRERASRASTWEGRRRLNTQTL |
Purity : | > 98% |
Applications : | WB; ELISA; FACS; FC |
Stability : | This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use. |
Storage : | At -20 centigrade. |
Concentration : | 1 mg/mL |
Storage Buffer : | PBS (pH 7.4-7.5). Sterile-filtered colorless solution. |
Reconstitution : | Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance. |
Gene Name | NCR1 natural cytotoxicity triggering receptor 1 [ Homo sapiens (human) ] |
Official Symbol | NCR1 |
Synonyms | NCR1; natural cytotoxicity triggering receptor 1; LY94, lymphocyte antigen 94 (mouse) homolog (activating NK receptor; NK p46); CD335; NK p46; NKP46; NK cell-activating receptor; natural killer cell p46-related protein; lymphocyte antigen 94 homolog (activating NK-receptor; NK-p46); LY94; NK-p46; FLJ99094; |
Gene ID | 9437 |
mRNA Refseq | NM_001145457 |
Protein Refseq | NP_001138929 |
MIM | 604530 |
UniProt ID | O76036 |
◆ Cell & Tissue Lysates | ||
NCR1-1244RCL | Recombinant Rat NCR1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NCR1 Products
Required fields are marked with *
My Review for All NCR1 Products
Required fields are marked with *
0
Inquiry Basket