Recombinant Human NCOA3, GST-tagged

• Cat.No.: NCOA3-121H
• Product Overview: Recombinant Human NCOA3(251 a.a. - 360 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: The protein encoded by this gene is a nuclear receptor coactivator that interacts with nuclear hormone receptors to enhance their transcriptional activator functions. The encoded protein has histone acetyltransferase activity and recruits p300/CBP-associated factor and CREB binding protein as part of a multisubunit coactivation complex. This protein is initially found in the cytoplasm but is translocated into the nucleus upon phosphorylation. Several transcript variants encoding different isoforms have been found for this gene. In addition, a polymorphic repeat region is found in the C-terminus of the encoded protein.
• Molecular Mass: 37.84 kDa
• AA Sequence: RRITTGERTFPSNPESFITRHDLSGKVVNIDTNSLRSSMRPGFEDIIRRCIQRFFSLNDGQSWSQKRHYQEAYLN GHAETPVYRFSLADGTIVTAQTKSKLFRNPVTNDR
• Applications: ELISA; WB-Re; AP; Array
• Storage: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: NCOA3 nuclear receptor coactivator 3 [ Homo sapiens (human) ]
• Official Symbol: NCOA3
• Synonyms: NCOA3; ACTR; AIB1; RAC3; SRC3; pCIP; AIB-1; CTG26; SRC-3; CAGH16; KAT13B; TNRC14; TNRC16; TRAM-1; bHLHe42; nuclear receptor coactivator 3; nuclear receptor coactivator 3; CBP-interacting protein; receptor-associated coactivator 3; amplified in breast cancer 1 protein; steroid receptor coactivator protein 3; class E basic helix-loop-helix protein 42; thyroid hormone receptor activator molecule 1; NP_001167558.1; EC 2.3.1.48; NP_001167559.1; NP_006525.2; NP_858045.1
• Gene ID: 8202
• mRNA Refseq: NM_006534
• Protein Refseq: NP_006525
• MIM: 601937
• UniProt ID: Q9Y6Q9
• Chromosome Location: 20q12
• Pathway: Androgen receptor signaling pathway; FOXA1 transcription factor network; Fatty acid, triacylglycerol, and ketone body metabolism
• Function: androgen receptor binding; histone acetyltransferase activity; ligand-dependent nuclear receptor binding