Recombinant Human NCL protein, GST-tagged
Cat.No. : | NCL-08H |
Product Overview : | Recombinant Human NCL(1 a.a. - 710 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 1-710 a.a. |
Description : | Nucleolin (NCL), a eukaryotic nucleolar phosphoprotein, is involved in the synthesis and maturation of ribosomes. It is located mainly in dense fibrillar regions of the nucleolus. Human NCL gene consists of 14 exons with 13 introns and spans approximately 11kb. The intron 11 of the NCL gene encodes a small nucleolar RNA, termed U20. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 103 kDa |
AA Sequence : | MVKLAKAGKNQGDPKKMAPPPKEVEEDSEDEEMSEDEEDDSSGEEVVIPQKKGKKAAATSAKKVVVSPTKKVAVA TPAKKAAVTPGKKAAATPAKKTVTPAKAVTTPGKKGATPGKALVATPGKKGAAIPAKGAKNGKNAKKEDSDEEED DDSEEDEEDDEDEDEDEDEIEPAAMKAAAAAPASEDEDDEDDEDDEDDDDDEEDDSEEEAMETTPAKGKKAAKVV PVKAKNVAEDEDEEEDDEDEDDDDDEDDEDDDDEDDEEEEEEEEEEPVKEAPGKRKKEMAKQKAAPEAKKQKVEG TEPTTAFNLFVGNLNFNKSAPELKTGISDVFAKNDLAVVDVRIGMTRKFGYVDFESAEDLEKALELTGLKVFGNE IKLEKPKGKDSKKERDARTLLAKNLPYKVTQDELKEVFEDAAEIRLVSKDGKSKGIAYIEFKTEADAEKTFEEKQ GTEIDGRSISLYYTGEKGQNQDYRGGKNSTWSGESKTLVLSNLSYSATEETLQEVFEKATFIKVPQNQNGKSKGY AFIEFASFEDAKEALNSCNKREIEGRAIRLELQGPRGSPNARSQPSKTLFVKGLSEDTTEETLKESFDGSVRARI VTDRETGSSKGFGFVDFNSEEDAKAAKEAMEDGEIDGNKVTLDWAKPKGEGGFGGRGGGRGGFGGRGGGRGGRGG FGGRGRGGFGGRGGFRGGRGGGGDHKPQGKKTKFE |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | NCL nucleolin [ Homo sapiens ] |
Official Symbol | NCL |
Synonyms | NCL; nucleolin; C23; FLJ45706; FLJ59041; |
Gene ID | 4691 |
mRNA Refseq | NM_005381 |
Protein Refseq | NP_005372 |
MIM | 164035 |
UniProt ID | P19338 |
Chromosome Location | 2q12-qter |
Pathway | Aurora B signaling, organism-specific biosystem; Pathogenic Escherichia coli infection, organism-specific biosystem; Pathogenic Escherichia coli infection, conserved biosystem; Regulation of Telomerase, organism-specific biosystem; T Cell Receptor Signaling Pathway, organism-specific biosystem; Validated targets of C-MYC transcriptional activation, organism-specific biosystem; |
Function | DNA binding; RNA binding; nucleic acid binding; nucleotide binding; protein C-terminus binding; protein binding; telomeric DNA binding; |
◆ Recombinant Proteins | ||
NCL-1488H | Recombinant Human NCL Protein, His (Fc)-Avi-tagged | +Inquiry |
NCL-1023H | Recombinant Human NCL protein, Fc-tagged | +Inquiry |
NCL-1024M | Recombinant Mouse NCL protein, mFc-tagged | +Inquiry |
NCL-6817C | Recombinant Chicken NCL | +Inquiry |
NCL-4672H | Recombinant Human NCL Protein (Asn478-Asn565), N-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NCL-1174HCL | Recombinant Human NCL cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NCL Products
Required fields are marked with *
My Review for All NCL Products
Required fields are marked with *
0
Inquiry Basket