Recombinant Human NCBP2 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: NCBP2-468H
• Product Overview: NCBP2 MS Standard C13 and N15-labeled recombinant protein (NP_001036005) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: The product of this gene is a component of the nuclear cap-binding protein complex (CBC), which binds to the monomethylated 5' cap of nascent pre-mRNA in the nucleoplasm. The encoded protein has an RNP domain commonly found in RNA binding proteins, and contains the cap-binding activity. The CBC promotes pre-mRNA splicing, 3'-end processing, RNA nuclear export, and nonsense-mediated mRNA decay. Multiple transcript variants encoding different isoforms have been found for this gene.
• Molecular Mass: 11.8 kDa
• AA Sequence: MSGGLLKALRSDSYVELSQYRDQHFRGDNEEQEKLLKKSYAENAMRYINGTRLDDRIIRTDWDAGFKEGRQYGRGRSGGQVRDEYRQDYDAGRGGYGKLAQNQSGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: NCBP2 nuclear cap binding protein subunit 2 [ Homo sapiens (human) ]
• Official Symbol: NCBP2
• Synonyms: NCBP2; nuclear cap binding protein subunit 2, 20kDa; nuclear cap binding protein subunit 2, 20kD; nuclear cap-binding protein subunit 2; Cbc2; CBP20; NIP1; NCBP 20 kDa subunit; NCBP interacting protein 1; NCBP-interacting protein 1; 20 kDa nuclear cap-binding protein; cell proliferation-inducing gene 55 protein; CBC2; PIG55
• Gene ID: 22916
• mRNA Refseq: NM_001042540
• Protein Refseq: NP_001036005
• MIM: 605133
• UniProt ID: P52298