Recombinant Human NCBP2 protein, GST-tagged

• Cat.No.: NCBP2-3266H
• Product Overview: Recombinant Human NCBP2 protein(P52298)(1-156aa), fused to N-terminal GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 1-156aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 44.9 kDa
• AA Sequence: SGGLLKALRSDSYVELSQYRDQHFRGDNEEQEKLLKKSCTLYVGNLSFYTTEEQIYELFSKSGDIKKIIMGLDKMKKTACGFCFVEYYSRADAENAMRYINGTRLDDRIIRTDWDAGFKEGRQYGRGRSGGQVRDEYRQDYDAGRGGYGKLAQNQ
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: NCBP2 nuclear cap binding protein subunit 2, 20kDa [ Homo sapiens ]
• Official Symbol: NCBP2
• Synonyms: NCBP2; nuclear cap binding protein subunit 2, 20kDa; nuclear cap binding protein subunit 2, 20kD; nuclear cap-binding protein subunit 2; Cbc2; CBP20; NIP1; NCBP 20 kDa subunit; NCBP interacting protein 1; NCBP-interacting protein 1; 20 kDa nuclear cap-binding protein; cell proliferation-inducing gene 55 protein; CBC2; PIG55
• Gene ID: 22916
• mRNA Refseq: NM_001042540
• Protein Refseq: NP_001036005
• MIM: 605133
• UniProt ID: P52298