Recombinant Human NCBP1

• Cat.No.: NCBP1-29294TH
• Product Overview: Recombinant fragment of Human NCBP1 with an N terminal proprietary tag; Predicted MW 36.41kDa.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 98 amino acids
• Description: The product of this gene is a component of the nuclear cap-binding protein complex (CBC), which binds to the monomethylated 5 cap of nascent pre-mRNA in the nucleoplasm. The encoded protein promotes high-affinity mRNA-cap binding and associates with the CTD of RNA polymerase II. The CBC promotes pre-mRNA splicing, 3-end processing, RNA nuclear export, and nonsense-mediated mRNA decay.
• Molecular Weight: 36.410kDa inclusive of tags
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: SRRRHSDENDGGQPHKRRKTSDANETEDHLESLICKVGEKSACSLESNLEGLAGVLEADLPNYKSKILRLLCTVARLLPEKLTIYTTLVGLLNARNYN
• Sequence Similarities: Belongs to the NCBP1 family.Contains 1 MIF4G domain.

Gene Information

• Gene Name: NCBP1 nuclear cap binding protein subunit 1, 80kDa [ Homo sapiens ]
• Official Symbol: NCBP1
• Synonyms: NCBP1; nuclear cap binding protein subunit 1, 80kDa; NCBP, nuclear cap binding protein subunit 1, 80kD; nuclear cap-binding protein subunit 1; CBP80; Sto1
• Gene ID: 4686
• mRNA Refseq: NM_002486
• Protein Refseq: NP_002477
• MIM: 600469
• Uniprot ID: Q09161
• Chromosome Location: 9q34.1
• Pathway: Abortive elongation of HIV-1 transcript in the absence of Tat, organism-specific biosystem; Cap binding complex, organism-specific biosystem; Cleavage of Growing Transcript in the Termination Region, organism-specific biosystem; Formation and Maturation of mRNA Transcript, organism-specific biosystem; Formation of HIV-1 elongation complex containing HIV-1 Tat, organism-specific biosystem
• Function: RNA binding; RNA cap binding; protein binding