Recombinant Human NCAN Protein, GST-tagged

• Cat.No.: NCAN-2014H
• Product Overview: Human CSPG3 partial ORF ( NP_004377, 81 a.a. - 179 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: Neurocan is a chondroitin sulfate proteoglycan thought to be involved in the modulation of cell adhesion and migration.[supplied by OMIM, Jul 2002]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 36.63 kDa
• AA Sequence: VRTASGQRQDLPILVAKDNVVRVAKSWQGRVSLPSYPRRRANATLLLGPLRASDSGLYRCQVVRGIEDEQDLVPLEVTGVVFHYRSARDRYALTFAEAQ
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: NCAN neurocan [ Homo sapiens ]
• Official Symbol: NCAN
• Synonyms: NCAN; neurocan; chondroitin sulfate proteoglycan 3 , CSPG3; neurocan core protein; neurocan proteoglycan; chondroitin sulfate proteoglycan 3 (neurocan); CSPG3; FLJ44681
• Gene ID: 1463
• mRNA Refseq: NM_004386
• Protein Refseq: NP_004377
• MIM: 600826
• UniProt ID: O14594