Recombinant Human NBR1

• Cat.No.: NBR1-27854TH
• Product Overview: Recombinant fragment of Human NBR1, amino acids 2-96: EPQVTLNVTF KNEIQSFLVS DPENTTWADI EAMVKVSFDL NTIQIKYLDE ENEEVSINSQ GEYEEALKMA VKQGNQLQMQ VHEGHHVVDE APPPV with a proprietary N-terminal tag, molecular weight 36.08 inclusive of tag

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 95 amino acids
• Description: The protein encoded by this gene was originally identified as an ovarian tumor antigen monitored in ovarian cancer. The encoded protein contains a B-box/coiled coil motif, which is present in many genes with transformation potential, but the function of this protein is unknown. This gene is located on a region of chromosome 17q21.1 that is in close proximity to tumor suppressor gene BRCA1. Three alternatively spliced variants encoding the same protein have been identified for this gene.
• Molecular Weight: 36.080kDa inclusive of tags
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: EPQVTLNVTFKNEIQSFLVSDPENTTWADIEAMVKVSFDLNTIQIKYLDEENEEVSINSQGEYEEALKMAVKQGNQLQMQVHEGHHVVDEAPPPV
• Sequence Similarities: Contains 1 OPR domain.Contains 1 UBA domain.Contains 1 ZZ-type zinc finger.

Gene Information

• Gene Name: NBR1 neighbor of BRCA1 gene 1 [ Homo sapiens ]
• Official Symbol: NBR1
• Synonyms: NBR1; neighbor of BRCA1 gene 1; M17S2, membrane component, chromosome 17, surface marker 2 (ovarian carcinoma antigen CA125); next to BRCA1 gene 1 protein; 1A1 3B; CA125; KIAA0049
• Gene ID: 4077
• mRNA Refseq: NM_005899
• Protein Refseq: NP_005890
• MIM: 166945
• Uniprot ID: Q14596
• Chromosome Location: 17q21.31
• Function: metal ion binding; mitogen-activated protein kinase p38 binding; protein binding; ubiquitin binding; zinc ion binding