Recombinant Human NAV1 protein, GST-tagged

• Cat.No.: NAV1-3690H
• Product Overview: Recombinant Human NAV1 protein(1359-1530 aa), fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 1359-1530 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH.
• AA Sequence: LKVAPGPSSGSTPGQVPGSSALSSPRRSLGLALTHSFGPSLADTDLSPMDGISTCGPKEEVTLRVVVRMPPQHIIKGDLKQQEFFLGCSKVSGKVDWKMLDEAVFQVFKDYISKMDPASTLGLSTESIHGYSISHVKRVLDAEPPEMPPCRRGVNNISVSLKGLKEKCVDSL
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: NAV1 neuron navigator 1 [ Homo sapiens ]
• Official Symbol: NAV1
• Synonyms: NAV1; neuron navigator 1; DKFZp781D0314; FLJ12560; FLJ14203; KIAA1151; MGC14961; POMFIL3; pore membrane and/or filament interacting like protein 3; steerin 1; unc-53 homolog 1; neuron navigator-1; pore membrane and/or filament-interacting-like protein 3; UNC53H1; STEERIN1
• Gene ID: 89796
• mRNA Refseq: NM_001167738
• Protein Refseq: NP_001161210
• MIM: 611628
• UniProt ID: Q8NEY1