Recombinant Human NAT9 Protein, His-tagged

• Cat.No.: NAT9-78H
• Product Overview: Recombinant Human NAT9 Protein, fused to His-tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Description: Predicted to enable N-acetyltransferase activity. Predicted to be involved in protein acetylation. Part of protein-containing complex.
• Form: Supplied as a 0.2 μm filtered solution in PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.0).
• Molecular Mass: ~24.4 kDa
• AA Sequence: MRLNQNTLLLGKKVVLVPYTSEHVPSRYHEWMKSEELQRLTASEPLTLEQEYAMQCSWQEDADKCTFIVLDAEKWQAQPGATEESCMVGDVNLFLTDLEDLTLGEIEVMIAEPSCRGKGLGTEAVLAMLSYGVTTLGLTKFEAKIGQGNEPSIRMFQKLHFEQVATSSVFQEVTLRLTVSESEHQWLLEQTSHVEEKPYRDGSAEPCLEHHHHHH
• Purity: >90%
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Concentration: 0.9mg/mL

Gene Information

• Gene Name: NAT9 N-acetyltransferase 9 (putative) [ Homo sapiens (human) ]
• Official Symbol: NAT9
• Synonyms: EBSP, hNATL
• Gene ID: 26151
• mRNA Refseq: NM_001305077
• Protein Refseq: NP_001292006
• UniProt ID: Q9BTE0