Recombinant human NAT9 protein, His-tagged

• Cat.No.: NAT9-1195H
• Product Overview: Recombinant NAT9 protein, fused to His-tag, was expressed in E.coli and purified by using conventional chromatography techniques.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• ProteinLength: 207
• Description: This gene encodes a N-acetyltransferase enzyme that is catalyze the transfer of an acetyl group to a nitrogen atom on the acceptor molecule.
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization.
• Molecular Mass: 39 kDa
• AA Sequence: MRLNQNTLLLGKKVVLVPYTSEHVPSRYHEWMKSEELQRLTASEPLTLEQEYAMQCSWQEDADKCTFIVLDAEKWQAQPGATEESCMVGDVNLFLTDLEDLTLGEIEVMIAEPSCRGKGLGTEAVLAMLSYGVTTLGLTKFEAKIGQGNEPSIRMFQKLHFEQVATSSVFQEVTLRLTVSESEHQWLLEQTSHVEEKPYRDGSAEPC
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining
• Storage: Short-term storage: Store at 2-8 centigrade for (1-2 weeks).
  Long-term storage: Aliquot and store at -20 centigrade to -80 centigrade for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage (see Stability and Storage for more details).
  If a different concentration is needed for your purposes please adjust the reconstitution volume as required (please note: the ion concentration of the final solution will vary according to the volume used).

Gene Information

• Gene Name: NAT9
• Official Symbol: NAT9
• Synonyms: EBSP, hNATL
• Gene ID: 26151
• mRNA Refseq: NM_015654.5
• Protein Refseq: NP_056469.2
• MIM: 600950
• UniProt ID: Q9BTE0