Recombinant Human NAT8L protein, GST-tagged
Cat.No. : | NAT8L-4954H |
Product Overview : | Human NAT8L full-length ORF ( NP_848652.1, 1 a.a. - 134 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 41.5 kDa |
AA Sequence : | MADIEQYYMKPPGSCFWVAVLDGNVVGIVAARAHEEDNTVELLRMSVDSRFRGKGIAKALGRKVLEFAVVHNYSAVVLGTTAVKVAAHKLYESLGFRHMGASDHYVLPGMTLSLAERLFFQVRYHRYRLQLREE |
Storage : | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Gene Name | NAT8L N-acetyltransferase 8 like [ Homo sapiens (human) ] |
Official Symbol | NAT8L |
Synonyms | CML3; NACED; NAT8-LIKE; NAT8L; FLJ37478 |
Gene ID | 339983 |
mRNA Refseq | NM_178557.3 |
Protein Refseq | NP_848652.2 |
UniProt ID | Q8N9F0 |
◆ Cell & Tissue Lysates | ||
NAT8L-3960HCL | Recombinant Human NAT8L 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NAT8L Products
Required fields are marked with *
My Review for All NAT8L Products
Required fields are marked with *
0
Inquiry Basket