Recombinant Human NAT8L protein, GST-tagged

Cat.No. : NAT8L-4954H
Product Overview : Human NAT8L full-length ORF ( NP_848652.1, 1 a.a. - 134 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 41.5 kDa
AA Sequence : MADIEQYYMKPPGSCFWVAVLDGNVVGIVAARAHEEDNTVELLRMSVDSRFRGKGIAKALGRKVLEFAVVHNYSAVVLGTTAVKVAAHKLYESLGFRHMGASDHYVLPGMTLSLAERLFFQVRYHRYRLQLREE
Storage : Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Gene Name NAT8L N-acetyltransferase 8 like [ Homo sapiens (human) ]
Official Symbol NAT8L
Synonyms CML3; NACED; NAT8-LIKE; NAT8L; FLJ37478
Gene ID 339983
mRNA Refseq NM_178557.3
Protein Refseq NP_848652.2
UniProt ID Q8N9F0

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All NAT8L Products

Required fields are marked with *

My Review for All NAT8L Products

Required fields are marked with *

0

Inquiry Basket

cartIcon