Recombinant Human NAT8B Protein, GST-tagged

• Cat.No.: NAT8B-1540H
• Product Overview: Human CML2 partial ORF ( NP_057431.1, 83 a.a. - 179 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: The protein encoded by this gene is highly similar to the N-acetyltransferase 8 (NAT8) gene product, which is a kidney and liver protein with homology to bacterial acetyltransferases involved in drug resistance. This gene is localized on chromosome 2 in the vicinity of the NAT8 gene and may represent a pseudogene of NAT8. This gene contains two polymorphic nonsense mutations that disrupt the active site of the protein. The full-length product of this gene contains a complete acetyltransferase domain and is identical in length to NAT8. [provided by RefSeq, Jul 2008]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 36.41 kDa
• AA Sequence: TRYVDIALRTDMSDITKSYLSECGSCFWVGESEEKVVGTVGALPVDDPTLREKRLQLFHLSVDNEHRGQGIAKALVRTVLQFARDQGYSEVVLDTSN
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: NAT8B N-acetyltransferase 8B (GCN5-related, putative, gene/pseudogene) [ Homo sapiens ]
• Official Symbol: NAT8B
• Synonyms: NAT8B; N-acetyltransferase 8B (GCN5-related, putative, gene/pseudogene); N acetyltransferase 8B (gene/pseudogene); probable N-acetyltransferase 8B; Hcml2; NAT8BP; camello-like protein 2; N-acetyltransferase Camello 2; N-acetyltransferase 8B (gene/pseudogene); CML2; MGC97061
• Gene ID: 51471
• mRNA Refseq: NM_016347
• Protein Refseq: NP_057431
• MIM: 608190
• UniProt ID: Q9UHF3