Recombinant Human NAA20 protein, T7-tagged

• Cat.No.: NAA20-171H
• Product Overview: Recombinant human NAA20 (178 aa, Isoform-A) fused with T7 Tag at N-terminal was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: T7
• ProteinLength: 178 a.a.
• Form: 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT.
• AA Sequence: MASMTGGQQMGRGEFMTTLRAFTCDDLFRFNNINLDPLTETYGIPFYLQYLAHWPEYFIVAEAPGGELMGYIMGK AEGSVAREEWHGHVTALSVAPEFRRLGLAAKLMELLEEISERKGGFFVDLFVRVSNQVAVNMYKQLGYSVYRTVI EYYSASNGEPDEDAYDMRKALSRDTEKKSIIPLPHPVRPEDIE
• Purity: >90% by SDS-PAGE
• Applications: 1. May be used for in vitro NatB mediated cell cycle regulation study with intracellular delivery of this protein.2. As soluble / native protein, may be used as enzymatic substrate protein for kinase and ubiquitin assay development.3. May be used for mapping NAA20 protein-protein interaction.4. Potential diagnostic biomarker for cancer.5. May be used as antigen for specific antibody development.
• Storage: Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days.

Gene Information

• Gene Name: NAA20 N(alpha)-acetyltransferase 20, NatB catalytic subunit [ Homo sapiens ]
• Official Symbol: NAA20
• Synonyms: NAA20; N(alpha)-acetyltransferase 20, NatB catalytic subunit; N acetyltransferase 5 , N acetyltransferase 5 (ARD1 homolog, S. cerevisiae) , N acetyltransferase 5 (GCN5 related, putative) , N acetyltransferase 5, ARD1 subunit (arrest defective 1, S. cerevisiae, homolog) , NAT5; N-alpha-acetyltransferase 20; dJ1002M8.1; N acetyltransferase 3 homolog (S. cerevisiae); NAT3; natB catalytic subunit; natB complex subunit NAT5; N-acetyltransferase 3 homolog; N-acetyltransferase 5 (GCN5-related, putative); N-terminal acetyltransferase complex ARD1 subunit; N-acetyltransferase 5 (ARD1 homolog, S. cerevisiae); N-alpha-acetyltransferase 20, NatB catalytic subunit; N-terminal acetyltransferase B complex catalytic subunit NAT5; N-terminal acetyltransferase B complex catalytic subunit NAA20; N-acetyltransferase 5, ARD1 subunit (arrest-defective 1, S. cerevisiae, homolog); NAT5
• Gene ID: 51126
• mRNA Refseq: NM_016100
• Protein Refseq: NP_057184
• MIM: 610833
• UniProt ID: P61599
• Chromosome Location: 20p11.23
• Function: N-acetyltransferase activity; peptide alpha-N-acetyltransferase activity; transferase activity, transferring acyl groups