Recombinant Human MYOT Protein, GST-tagged
Cat.No. : | MYOT-5856H |
Product Overview : | Human MYOT full-length ORF ( NP_006781.1, 1 a.a. - 498 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a cystoskeletal protein which plays a significant role in the stability of thin filaments during muscle contraction. This protein binds F-actin, crosslinks actin filaments, and prevents latrunculin A-induced filament disassembly. Mutations in this gene have been associated with limb-girdle muscular dystrophy and myofibrillar myopathies. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been determined |
Molecular Mass : | 81.8 kDa |
AA Sequence : | MFNYERPKHFIQSQNPCGSRLQPPGPETSSFSSQTKQSSIIIQPRQCTEQRFSASSTLSSHITMSSSAFPASPQQHAGSNPGQRVTTTYNQSPASFLSSILPSQPDYNSSKIPSAMDSNYQQSSAGQPINAKPSQTANAKPIPRTPDHEIQGSKEALIQDLERKLKCKDTLLHNGNQRLTYEEKMARRLLGPQNAAAVFQAQDDSGAQDSQQHNSEHARLQVPTSQVRSRSTSRGDVNDQDAIQEKFYPPRFIQVPENMSIDEGRFCRMDFKVSGLPAPDVSWYLNGRTVQSDDLHKMIVSEKGLHSLIFEVVRASDAGAYACVAKNRAGEATFTVQLDVLAKEHKRAPMFIYKPQSKKVLEGDSVKLECQISAIPPPKLFWKRNNEMVQFNTDRISLYQDNTGRVTLLIKDVNKKDAGWYTVSAVNEAGVTTCNTRLDVTARPNQTLPAPKQLRVRPTFSKYLALNGKGLNVKQAFNPEGEFQRLAAQSGLYESEEL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MYOT myotilin [ Homo sapiens ] |
Official Symbol | MYOT |
Synonyms | MYOT; myotilin; LGMD1, LGMD1A, limb girdle muscular dystrophy 1A (autosomal dominant) , titin immunoglobulin domain protein (myotilin) , TTID; 57 kDa cytoskeletal protein; myofibrillar titin-like Ig domains protein; titin immunoglobulin domain protein (myotilin); TTID; LGMD1; LGMD1A; |
Gene ID | 9499 |
mRNA Refseq | NM_001135940 |
Protein Refseq | NP_001129412 |
MIM | 604103 |
UniProt ID | Q9UBF9 |
◆ Recombinant Proteins | ||
MYOT-5856H | Recombinant Human MYOT Protein, GST-tagged | +Inquiry |
Myot-1811M | Recombinant Mouse Myot Protein, His-tagged | +Inquiry |
MYOT-6616HF | Recombinant Full Length Human MYOT Protein, GST-tagged | +Inquiry |
MYOT-556H | Recombinant Human MYOT protein, GST-tagged | +Inquiry |
MYOT-2496H | Recombinant Human MYOT Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MYOT-4003HCL | Recombinant Human MYOT 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MYOT Products
Required fields are marked with *
My Review for All MYOT Products
Required fields are marked with *
0
Inquiry Basket