Recombinant Human Myostatin Propeptide

Cat.No. : MSTN-210H
Product Overview : Recombinant Human Myostatin Propeptide without tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Protein Length : 24-266
Description : Myostatin (GDF-8), a member of the TGF-beta superfamily, is a potent and negative regulator of skeletal muscle mass. The recombinant myostatin propeptide binds and inhibits myostatin to enhance the repair and regeneration of injured muscle and bone.
Bio-activity : No biological activity data is available at this time.
Molecular Mass : Monomer, 27.8 kDa (244 aa)
AA Sequence : MNENSEQKENVEKEGLCNACTWRQNTKSSRIEAIKIQILSKLRLETAPNISKDVIRQLLPKAPPLRELIDQYDVQRDDSSDGSLEDDDYHATTETIITMPTESDFLMQVDGKPKCCFFKFSSKIQYNKVVKAQLWIYLRPVETPTTVFVQILRLIKPMKDGTRYTGIRSLKLDMNPGTGIWQSIDVKTVLQNWLKQPESNLGIEIKALDENGHDLAVTFPGPGEDGLNPFLEVKVTDTPKRSRR
Endotoxin : ≤1 EUs/μg, Kinetic LAL
Purity : ≥95%, Reducing and Non-Reducing SDS PAGE
Stability : 12 months from date of receipt when stored at -20 to -80 centigrade as supplied.
1 month when stored at 4 centigrade after reconstituting as directed.
3 months when stored at -20 to -80 centigrade after reconstituting as directed.
Storage : Storage Prior to Reconstitution: -20 centigrade
Storage Buffer : Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA)
Reconstitution : Sterile 20 mM HCl at 0.1 mg/mL
Shipping : Room temperature
Instructions : Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws.
Gene Name MSTN myostatin [ Homo sapiens (human) ]
Official Symbol MSTN
Synonyms MSTN; myostatin; GDF8, growth differentiation factor 8; growth/differentiation factor 8; GDF-8; growth differentiation factor 8; GDF8; MSLHP;
Gene ID 2660
mRNA Refseq NM_005259
Protein Refseq NP_005250
MIM 601788
UniProt ID O14793

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All MSTN Products

Required fields are marked with *

My Review for All MSTN Products

Required fields are marked with *

0

Inquiry Basket

cartIcon