Specification
Gene Information
Related Products
Download

Description :	Myostatin (GDF-8), a member of the TGF-beta superfamily, is a potent and negative regulator of skeletal muscle mass. The recombinant myostatin propeptide binds and inhibits myostatin to enhance the repair and regeneration of injured muscle and bone.
Source :	E. coli
Species :	Human
Bio-activity :	No biological activity data is available at this time.
Molecular Mass :	Monomer, 27.8 kDa (244 aa)
Protein length :	24-266
AA Sequence :	MNENSEQKENVEKEGLCNACTWRQNTKSSRIEAIKIQILSKLRLETAPNISKDVIRQLLPKAPPLRELIDQYDVQRDDSSDGSLEDDDYHATTETIITMPTESDFLMQVDGKPKCCFFKFSSKIQYNKVVKAQLWIYLRPVETPTTVFVQILRLIKPMKDGTRYTGIRSLKLDMNPGTGIWQSIDVKTVLQNWLKQPESNLGIEIKALDENGHDLAVTFPGPGEDGLNPFLEVKVTDTPKRSRR
Endotoxin :	≤1 EUs/μg, Kinetic LAL
Purity :	≥95%, Reducing and Non-Reducing SDS PAGE
Stability :	12 months from date of receipt when stored at -20 to -80 centigrade as supplied. 1 month when stored at 4 centigrade after reconstituting as directed. 3 months when stored at -20 to -80 centigrade after reconstituting as directed.
Storage :	Storage Prior to Reconstitution: -20 centigrade
Storage Buffer :	Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA)
Reconstitution :	Sterile 20 mM HCl at 0.1 mg/mL
Shipping :	Room temperature
Instructions :	Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws.

Gene Name	MSTN myostatin [ Homo sapiens (human) ]
Official Symbol	MSTN
Synonyms	MSTN; myostatin; GDF8, growth differentiation factor 8; growth/differentiation factor 8; GDF-8; growth differentiation factor 8; GDF8; MSLHP;
Gene ID	2660
mRNA Refseq	NM_005259
Protein Refseq	NP_005250
MIM	601788
UniProt ID	O14793