Description :	The protein encoded by this gene is a member of the bone morphogenetic protein (BMP) family and the TGF-beta superfamily. This group of proteins is characterized by a polybasic proteolytic processing site which is cleaved to produce a mature protein containing seven conserved cysteine residues. The members of this family are regulators of cell growth and differentiation in both embryonic and adult tissues. This gene is thought to encode a secreted protein which negatively regulates skeletal muscle growth.
Source :	Wheat germ
Species :	Human
Tag :	GST
Molecular Mass :	34.63 kDa
AA Sequence :	MPTESDFLMQVDGKPKCCFFKFSSKIQYNKVVKAQLWIYLRPVETPTTVFVQILRLIKPMKDGTRYTGIRSLKLD MNPGTGI
Applications :	ELISA; WB-Re; AP; Array
Notes :	Best use within three months from the date of receipt of this protein.
Storage :	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Storage Buffer :	50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Name	MSTN myostatin [ Homo sapiens (human) ]
Official Symbol	MSTN
Synonyms	MSTN; myostatin; GDF8; MSLHP; growth/differentiation factor 8; GDF-8; growth differentiation factor 8
Gene ID	2660
mRNA Refseq	NM_005259
Protein Refseq	NP_005250
MIM	601788
UniProt ID	O14793
Chromosome Location	2q32.2
Pathway	Hypertrophy Model
Function	cytokine activity; growth factor ; heparin binding; identical protein binding