Recombinant Human MYO9B Protein, GST-tagged

• Cat.No.: MYO9B-5848H
• Product Overview: Human MYO9B partial ORF ( AAH18108, 201 a.a. - 290 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a member of the myosin family of actin-based molecular motor heavy chain proteins. The protein represents an unconventional myosin; it should not be confused with the conventional non-muscle myosin-9 (MYH9). The protein has four IQ motifs located in the neck domain that bind calmodulin, which serves as a light chain. The protein complex has a single-headed structure and exhibits processive movement on actin filaments toward the minus-end. The protein also has rho-GTPase activity. Polymorphisms in this gene are associated with celiac disease and ulcerative colitis susceptibility. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Dec 2011]
• Molecular Mass: 35.64 kDa
• AA Sequence: CPDNSDPLTSMKDVLKITTCVEMLIKEQMRKYKVKMEEISQLEAAESIAFRRLSLLRQNAPWPLKLGFSSPYEGVLNKSPKTRDIQEEEL
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MYO9B myosin IXB [ Homo sapiens ]
• Official Symbol: MYO9B
• Synonyms: MYO9B; myosin IXB; CELIAC4; unconventional myosin-IXb; myosin-IXb; unconventional myosin-9b; unconventional myosin IXb; MYR5
• Gene ID: 4650
• mRNA Refseq: NM_001130065
• Protein Refseq: NP_001123537
• MIM: 602129
• UniProt ID: Q13459