Recombinant Human MYO7A Protein, GST-tagged

• Cat.No.: MYO7A-5844H
• Product Overview: Human MYO7A partial ORF ( NP_000251, 2118 a.a. - 2213 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene is a member of the myosin gene family. Myosins are mechanochemical proteins characterized by the presence of a motor domain, an actin-binding domain, a neck domain that interacts with other proteins, and a tail domain that serves as an anchor. This gene encodes an unconventional myosin with a very short tail. Defects in this gene are associated with the mouse shaker-1 phenotype and the human Usher syndrome 1B which are characterized by deafness, reduced vestibular function, and (in human) retinal degeneration. Alternative splicing results in multiple transcript variants. [provided by RefSeq
• Molecular Mass: 36.3 kDa
• AA Sequence: KQTTEPNFPEILLIAINKYGVSLIDPKTKDILTTHPFTKISNWSSGNTYFHITIGNLVRGSKLLCETSLGYKMDDLLTSYISQMLTAMSKQRGSRS
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MYO7A myosin VIIA [ Homo sapiens ]
• Official Symbol: MYO7A
• Synonyms: MYO7A; myosin VIIA; DFNA11, DFNB2, myosin VIIA (Usher syndrome 1B (autosomal recessive, severe)) , USH1B; unconventional myosin-VIIa; NSRD2; myosin-VIIa; myosin VIIA (Usher syndrome 1B (autosomal recessive, severe)); DFNB2; MYU7A; USH1B; DFNA11; MYOVIIA
• Gene ID: 4647
• mRNA Refseq: NM_000260
• Protein Refseq: NP_000251
• MIM: 276903
• UniProt ID: Q13402