Recombinant Human MYL9 Protein, GST-tagged
Cat.No. : | MYL9-5817H |
Product Overview : | Human MYL9 full-length ORF ( AAH02648.1, 1 a.a. - 118 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Myosin, a structural component of muscle, consists of two heavy chains and four light chains. The protein encoded by this gene is a myosin light chain that may regulate muscle contraction by modulating the ATPase activity of myosin heads. The encoded protein binds calcium and is activated by myosin light chain kinase. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq |
Molecular Mass : | 38.72 kDa |
AA Sequence : | MSSKRAKAKTTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLASLGFIHEDHLRELLTTMGDRFTDEEVDEMYREAPIDKKGNFNYVEFTRILKHGAKDKDD |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MYL9 myosin, light chain 9, regulatory [ Homo sapiens ] |
Official Symbol | MYL9 |
Synonyms | MYL9; myosin, light chain 9, regulatory; myosin, light polypeptide 9, regulatory; myosin regulatory light polypeptide 9; LC20; MLC2; MRLC1; myosin regulatory light chain 1; myosin regulatory light chain 2; smooth muscle isoform; MYRL2; myosin RLC; 20 kDa myosin light chain; myosin regulatory light chain 9; myosin regulatory light chain MRLC1; myosin regulatory light chain 2, smooth muscle isoform; MLC-2C; MGC3505; |
Gene ID | 10398 |
mRNA Refseq | NM_006097 |
Protein Refseq | NP_006088 |
MIM | 609905 |
UniProt ID | P24844 |
◆ Recombinant Proteins | ||
MYL9-5817H | Recombinant Human MYL9 Protein, GST-tagged | +Inquiry |
Myl9-57M | Recombinant Mouse Myl9, His-tagged | +Inquiry |
MYL9-6765HF | Recombinant Full Length Human MYL9 Protein, GST-tagged | +Inquiry |
MYL9-3445H | Recombinant Human MYL9 protein, His-tagged | +Inquiry |
MYL9-3447H | Recombinant Human MYL9 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
MYL9-4019HCL | Recombinant Human MYL9 293 Cell Lysate | +Inquiry |
MYL9-4020HCL | Recombinant Human MYL9 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MYL9 Products
Required fields are marked with *
My Review for All MYL9 Products
Required fields are marked with *
0
Inquiry Basket