Recombinant Human MYL6, His-tagged

• Cat.No.: MYL6-30266TH
• Product Overview: Recombinant full length Human MYL6 with an N terminal His tag; 171 amino acids with a predicted MWt 19.1 kDa including tag.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• ProteinLength: 151 amino acids
• Description: Myosin is a hexameric ATPase cellular motor protein. It is composed of two heavy chains, two nonphosphorylatable alkali light chains, and two phosphorylatable regulatory light chains. This gene encodes a myosin alkali light chain that is expressed in smooth muscle and non-muscle tissues. Genomic sequences representing several pseudogenes have been described and two transcript variants encoding different isoforms have been identified for this gene.
• Conjugation: HIS
• Molecular Weight: 19.100kDa inclusive of tags
• Form: Liquid
• Purity: >90% by SDS-PAGE
• Storage buffer: Preservative: NoneConstituents: 10% Glycerol, 20mM Tris HCl, 1mM DTT, pH 8.0
• Storage: Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
• Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMCDFTEDQTAEFKEAFQLFDRTGDGKILYSQCGDVMRALGQNPTNAEVLKVLGNPKSDEMNVKVLDFEHFLPMLQTVAKNKDQGTYEDYVEGLRVFDKEGNGTVMGAEIRHVLVTLGEKMTEEEVEMLVAGHEDSNGCINYEELVRMVLNG
• Sequence Similarities: Contains 3 EF-hand domains.

Gene Information

• Gene Name: MYL6 myosin, light chain 6, alkali, smooth muscle and non-muscle [ Homo sapiens ]
• Official Symbol: MYL6
• Synonyms: MYL6; myosin, light chain 6, alkali, smooth muscle and non-muscle; myosin, light polypeptide 6, alkali, smooth muscle and non muscle; myosin light polypeptide 6; ESMLC; MLC1SM; MLC3NM
• Gene ID: 4637
• mRNA Refseq: NM_021019
• Protein Refseq: NP_066299
• MIM: 609931
• Uniprot ID: P60660
• Chromosome Location: 12q13.13
• Pathway: Axon guidance, organism-specific biosystem; Developmental Biology, organism-specific biosystem; Focal Adhesion, organism-specific biosystem; Muscle contraction, organism-specific biosystem; Sema4D in semaphorin signaling, organism-specific biosystem
• Function: actin-dependent ATPase activity; calcium ion binding; motor activity; protein binding; structural constituent of muscle