Recombinant Human CT83 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: CT83-2451H
• Product Overview: CXorf61 MS Standard C13 and N15-labeled recombinant protein (NP_001017978) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: CT83 (Cancer/Testis Antigen 83) is a Protein Coding gene. Diseases associated with CT83 include Lung Cancer and Prune Belly Syndrome.
• Molecular Mass: 12.8 kDa
• AA Sequence: MNFYLLLASSILCALIVFWKYRRFQRNTGEMSSNSTALALVRPSSSGLINSNTDNNLAVYDLSRDILNNFPHSIARQKRILVNLSMVENKLVELEHTLLSKGFRGASPHRKSTTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: CT83 cancer/testis antigen 83 [ Homo sapiens (human) ]
• Official Symbol: CT83
• Synonyms: CT83; cancer/testis antigen 83; KKLC1; CXorf61; KK-LC-1; kita-kyushu lung cancer antigen 1
• Gene ID: 203413
• mRNA Refseq: NM_001017978
• Protein Refseq: NP_001017978
• MIM: 300625
• UniProt ID: Q5H943