Recombinant Human CT83 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | CT83-2451H |
Product Overview : | CXorf61 MS Standard C13 and N15-labeled recombinant protein (NP_001017978) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Description : | CT83 (Cancer/Testis Antigen 83) is a Protein Coding gene. Diseases associated with CT83 include Lung Cancer and Prune Belly Syndrome. |
Molecular Mass : | 12.8 kDa |
AA Sequence : | MNFYLLLASSILCALIVFWKYRRFQRNTGEMSSNSTALALVRPSSSGLINSNTDNNLAVYDLSRDILNNFPHSIARQKRILVNLSMVENKLVELEHTLLSKGFRGASPHRKSTTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | CT83 cancer/testis antigen 83 [ Homo sapiens (human) ] |
Official Symbol | CT83 |
Synonyms | CT83; cancer/testis antigen 83; KKLC1; CXorf61; KK-LC-1; kita-kyushu lung cancer antigen 1 |
Gene ID | 203413 |
mRNA Refseq | NM_001017978 |
Protein Refseq | NP_001017978 |
MIM | 300625 |
UniProt ID | Q5H943 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All CT83 Products
Required fields are marked with *
My Review for All CT83 Products
Required fields are marked with *
0
Inquiry Basket