Recombinant Human MYL5 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: MYL5-2489H
• Product Overview: MYL5 MS Standard C13 and N15-labeled recombinant protein (NP_002468) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: Myc&DDK
• Description: This gene encodes one of the myosin light chains, a component of the hexameric ATPase cellular motor protein myosin. Myosin is composed of two heavy chains, two nonphosphorylatable alkali light chains, and two phosphorylatable regulatory light chains. This gene product, one of the regulatory light chains, is expressed in fetal muscle and in adult retina, cerebellum, and basal ganglia.
• Molecular Mass: 19.4 kDa
• AA Sequence: MASRKTKKKEGGALRAQRASSNVFSNFEQTQIQEFKEAFTLMDQNRDGFIDKEDLKDTYASLGKTNVKDDELDAMLKEASGPINFTMFLNLFGEKLSGTDAEETILNAFKMLDPDGKGKINKEYIKRLLMSQADKMTAEEVDQMFQFASIDVAGNLDYKALSYVITHGEEKEETRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: MYL5 myosin light chain 5 [ Homo sapiens (human) ]
• Official Symbol: MYL5
• Synonyms: MYL5; myosin, light chain 5, regulatory; myosin, light polypeptide 5, regulatory; myosin light chain 5; MYLC2; myLC-2; myosin regulatory light chain 5; superfast myosin regulatory light chain 2
• Gene ID: 4636
• mRNA Refseq: NM_002477
• Protein Refseq: NP_002468
• MIM: 160782
• UniProt ID: Q02045