Recombinant Human CGGBP1 Protein, GST-Tagged

• Cat.No.: CGGBP1-1191H
• Product Overview: Human CGGBP1 full-length ORF (NP_001008391.1, 1 a.a. - 167 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: CGGBP1 influences expression of the FMR1 gene (MIM 309550), which is associated with the fragile X mental retardation syndrome (MIM 300624), by specifically interacting with the 5-prime (CGG)n-3-prime repeat in its 5-prime UTR.[supplied by OMIM, Mar 2008]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 45.2 kDa
• AA Sequence: MERFVVTAPPARNRSKTALYVTPLDRVTEFGGELHEDGGKLFCTSCNVVLNHVRKSAISDHLKSKTHTKRKAEFEEQNVRKKQRPLTASLQCNSTAQTEKVSVIQDFVKMCLEANIPLEKADHPAVRAFLSRHVKNGGSIPKSDQLRRAYLPDGYENENQLLNSQDC
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CGGBP1 CGG triplet repeat binding protein 1 [ Homo sapiens ]
• Official Symbol: CGGBP1
• Synonyms: CGGBP1; CGG triplet repeat binding protein 1; CGG triplet repeat-binding protein 1; CGGBP; p20 CGG binding protein; p20 CGGBP; CGG-binding protein 1; p20-CGG binding protein; 20 kDa CGG-binding protein; p20-CGGBP DNA-binding protein; p20-CGGBP
• Gene ID: 8545
• mRNA Refseq: NM_001008390
• Protein Refseq: NP_001008391
• MIM: 603363
• UniProt ID: Q9UFW8