Recombinant Human MYL4, His-tagged

• Cat.No.: MYL4-30265TH
• Product Overview: Recombinant full length Human MYL4 (amino acids 1-197) with a C terminal His tag; 205aa, 22.6kDa.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 197 amino acids
• Description: Myosin is a hexameric ATPase cellular motor protein. It is composed of two myosin heavy chains, two nonphosphorylatable myosin alkali light chains, and two phosphorylatable myosin regulatory light chains. This gene encodes a myosin alkali light chain that is found in embryonic muscle and adult atria. Two alternatively spliced transcript variants encoding the same protein have been found for this gene.
• Conjugation: HIS
• Molecular Weight: 22.600kDa inclusive of tags
• Form: Liquid
• Purity: >90% by SDS-PAGE
• Storage buffer: pH: 8.00Constituents:0.32% Tris HCl, 20% Glycerol, 0.02% DTT, 0.88% Sodium chloride
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
• Sequences of amino acids: MAPKKPEPKKEAAKPAPAPAPAPAPAPAPAPEAPKEPAFD PKSVKIDFTADQIEEFKEAFSLFDRTPTGEMKITYGQCGD VLRALGQNPTNAEVLRVLGKPKPEEMNVKMLDFETFLPIL QHISRNKEQGTYEDFVEGLRVFDKESNGTVMGAELRHVLA TLGEKMTEAEVEQLLAGQEDANGCINYEAFVKHIMSGLEH HHHHH
• Sequence Similarities: Contains 3 EF-hand domains.

Gene Information

• Gene Name: MYL4 myosin, light chain 4, alkali; atrial, embryonic [ Homo sapiens ]
• Official Symbol: MYL4
• Synonyms: MYL4; myosin, light chain 4, alkali; atrial, embryonic; myosin, light polypeptide 4, alkali; atrial, embryonic; myosin light chain 4; ALC1; AMLC; GT1; myosin; atrial/fetal muscle; light chain; PRO1957
• Gene ID: 4635
• mRNA Refseq: NM_001002841
• Protein Refseq: NP_001002841
• MIM: 160770
• Uniprot ID: P12829
• Chromosome Location: 17q21-qter
• Pathway: Muscle contraction, organism-specific biosystem; Myometrial Relaxation and Contraction Pathways, organism-specific biosystem; Striated Muscle Contraction, organism-specific biosystem; Striated Muscle Contraction, organism-specific biosystem
• Function: actin filament binding; actin monomer binding; calcium ion binding; myosin II heavy chain binding; structural constituent of muscle