Recombinant Human MYL12B Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: MYL12B-3637H
• Product Overview: MYL12B MS Standard C13 and N15-labeled recombinant protein (NP_001138418) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: The activity of nonmuscle myosin II (see MYH9) is regulated by phosphorylation of a regulatory light chain, such as MRLC2. This phosphorylation results in higher MgATPase activity and the assembly of myosin II filaments.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 17.6 kDa
• AA Sequence: MSSMFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLASLGKNPTDAYLDAMMNEAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEATGTIQEDYLRELLTTMGDRFTDEEVDELYREAPIDKKGNFNYIEFTRILKHGAKDKDDTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: MYL12B myosin light chain 12B [ Homo sapiens (human) ]
• Official Symbol: MYL12B
• Synonyms: MYL12B; myosin, light chain 12B, regulatory; myosin regulatory light chain 12B; MRLC2; myosin regulatory light chain 2; MLC-2; MLC20; MLC-2A; SHUJUN-1; myosin regulatory light chain MRLC2; myosin regulatory light chain 20 kDa; myosin regulatory light chain 2-B, smooth muscle isoform; MLC-B
• Gene ID: 103910
• mRNA Refseq: NM_001144946
• Protein Refseq: NP_001138418
• MIM: 609211
• UniProt ID: O14950