Recombinant Human MYH9, GST-tagged

• Cat.No.: MYH9-29H
• Product Overview: Recombinant Human MYH9(131 a.a. - 220 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a conventional non-muscle myosin; this protein should not be confused with the unconventional myosin-9a or 9b (MYO9A or MYO9B). The encoded protein is a myosin IIA heavy chain that contains an IQ domain and a myosin head-like domain which is involved in several important functions, including cytokinesis, cell motility and maintenance of cell shape. Defects in this gene have been associated with non-syndromic sensorineural deafness autosomal dominant type 17, Epstein syndrome, Alport syndrome with macrothrombocytopenia, Sebastian syndrome, Fechtner syndrome and macrothrombocytopenia with progressive sensorineural deafness.
• Molecular Mass: 35.64 kDa
• AA Sequence: RLKQLKRQLEEAEEEAQRANASRRKLQRELEDATETADAMNREVSSLKNKLRRGDLPFVVPRRMARKGAGDGSDE EVDGKADGAEAKPAE
• Applications: ELISA; WB-Re; AP; Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MYH9 myosin, heavy chain 9, non-muscle [ Homo sapiens (human) ]
• Official Symbol: MYH9
• Synonyms: MYH9; myosin, heavy chain 9, non-muscle; DFNA17, myosin, heavy polypeptide 9, non muscle; myosin-9; EPSTS; FTNS; MHA; NMHC II A; NMMHCA; nonmuscle myosin heavy chain II A
• Gene ID: 4627
• mRNA Refseq: NM_002473
• Protein Refseq: NP_002464
• MIM: 160775
• UniProt ID: P35579
• Chromosome Location: 22q13.1
• Pathway: Axon guidance; Developmental Biology; EPHA-mediated growth cone collapse; Regulation of actin cytoskeleton
• Function: ADP binding; contributes_to actin filament binding; contributes_to actin-dependent ATPase activity