Recombinant Human MYF6

• Cat.No.: MYF6-29361TH
• Product Overview: Recombinant fragment of Human MYF6 with N terminal proprietary tag, predicted mwt: 36.52 kDa.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 99 amino acids
• Description: The protein encoded by this gene is a probable basic helix-loop-helix (bHLH) DNA binding protein involved in muscle differentiation. The encoded protein likely acts as a heterodimer with another bHLH protein. Defects in this gene are a cause of autosomal dominant centronuclear myopathy (ADCNM).
• Molecular Weight: 36.520kDa inclusive of tags
• Tissue specificity: Skeletal muscle.
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: MMMDLFETGSYFFYLDGENVTLQPLEVAEGSPLYPGSDGTLSPCQDQMPPEAGSDSSGEEHVLAPPGLQPPHCPGQCLIWACKTCKRKSAPTDRRKAAT
• Sequence Similarities: Contains 1 basic helix-loop-helix (bHLH) domain.

Gene Information

• Gene Name: MYF6 myogenic factor 6 (herculin) [ Homo sapiens ]
• Official Symbol: MYF6
• Synonyms: MYF6; myogenic factor 6 (herculin); myogenic factor 6; bHLHc4; MRF4
• Gene ID: 4618
• mRNA Refseq: NM_002469
• Protein Refseq: NP_002460
• MIM: 159991
• Uniprot ID: P23409
• Chromosome Location: 12q21
• Pathway: C-MYB transcription factor network, organism-specific biosystem; CDO in myogenesis, organism-specific biosystem; Developmental Biology, organism-specific biosystem; Diurnally regulated genes with circadian orthologs, organism-specific biosystem; Id Signaling Pathway, organism-specific biosystem
• Function: DNA binding; contributes_to E-box binding; protein heterodimerization activity; sequence-specific DNA binding transcription factor activity