Recombinant Human MYCT1 Protein, GST-tagged
Cat.No. : | MYCT1-5795H |
Product Overview : | Human MYCT1 full-length ORF (BAB15035.1, 1 a.a. - 235 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | MYCT1 (MYC Target 1) is a Protein Coding gene. Among its related pathways are Validated targets of C-MYC transcriptional activation. |
Molecular Mass : | 53 kDa |
AA Sequence : | MRTQVYEGLCKNYFSLAVLQRDRIKLLFFDILVFLSVFLLFLLFLVDIMANNTTSLGSPWPENFWEDLIMSFTVSMAIGLVLGGFIWAVFICLSRRRRASAPISQWSSSRRSRSSYTHGLNRTGFYRHSGCERRSNLSLASLTFQRRASLEQANSFPRKSSFRASTFHPFLQCPPLPVETESQLVTLPSSNISPTISTSHSLSRPDYWSSNSLRVGLSTPPPPAYESIIKAFPDS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MYCT1 myc target 1 [ Homo sapiens ] |
Official Symbol | MYCT1 |
Synonyms | MYCT1; myc target 1; myc target protein 1; FLJ21269; MTLC; myc target in myeloid cells 1; myc target in myeloid cells protein 1; MGC156309; MGC156310; |
Gene ID | 80177 |
mRNA Refseq | NM_025107 |
Protein Refseq | NP_079383 |
UniProt ID | Q8N699 |
◆ Recombinant Proteins | ||
MYCT1-5795H | Recombinant Human MYCT1 Protein, GST-tagged | +Inquiry |
MYCT1-1643H | Recombinant Human MYCT1 | +Inquiry |
MYCT1-2736R | Recombinant Rhesus Macaque MYCT1 Protein, His (Fc)-Avi-tagged | +Inquiry |
MYCT1-5834M | Recombinant Mouse MYCT1 Protein, His (Fc)-Avi-tagged | +Inquiry |
MYCT1-6730HF | Recombinant Full Length Human MYCT1 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MYCT1-4035HCL | Recombinant Human MYCT1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MYCT1 Products
Required fields are marked with *
My Review for All MYCT1 Products
Required fields are marked with *
0
Inquiry Basket